Details for Lyrate rockcress Locus 16051416

Position : sca3 ( 5`- 12855296 .. 12854127 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051416

Protein [Map View]
MWNEFGFSSMSINLHRVSPIEVTGELNLIDPHSSLDQFGTSLLCHTYFFFFDNPGIRTEARLAPRLEAGSLSGRPSPTLS
VFPGGPRGPGENLGGQRESNCGHHIGITPSSTTSPTHVGFCHTYYGLLLCVCDNNEVESTSLVVWNPCTGQTKWIQHRKL
CYICTYALGSYQDNKSGNKSYKILSRRFYGHQDPEFEIYEINSNSWRRILDVNVDCTDMYIRNVSLKGKTYWFATDEKEK
QLGLFLISFDHTTERFERLCLPYPHPYHGYQNEYLSVVREEKLSVLLQPVDLTPEPKFDMLLLVDVEKKVLVYTQNNGYK
SQTMVYIVGEDNKVREVAFGDAFKPFLLNYVPSLTQIQQGDD*

DNA
ATGTGGAATGAGTTTGGGTTTTCTTCGATGAGCATCAATCTACATAGAGTTTCACCTATAGAGGTCACTGGTGAACTTAA
CCTAATCGACCCTCATTCTAGTTTAGATCAGTTCGGGACCTCTCTACTCTGCCACACTTATTTTTTTTTTTTTGATAATC
CAGGTATCCGGACCGAAGCCCGACTAGCACCAAGGCTTGAGGCCGGTTCCCTGTCGGGCCGTCCGAGCCCAACGCTCAGT
GTGTTTCCTGGAGGCCCGAGGGGGCCCGGTGAAAACCTCGGTGGCCAACGGGAATCGAACTGCGGGCACCATATTGGGAT
TACCCCCTCAAGTACCACTAGCCCAACCCACGTTGGTTTCTGCCACACTTATTATGGCTTATTGTTATGCGTCTGTGACA
ACAACGAGGTGGAAAGTACTAGCCTCGTGGTGTGGAACCCGTGTACCGGTCAAACCAAGTGGATCCAACACAGAAAGCTT
TGCTACATCTGTACCTATGCTCTTGGTTCTTACCAAGACAACAAATCTGGCAATAAGAGCTACAAAATATTGAGCCGCAG
GTTTTATGGTCACCAAGACCCAGAATTCGAAATTTATGAGATTAACTCGAATTCATGGAGGAGGATCCTTGATGTCAATG
TGGACTGCACCGATATGTACATTCGGAACGTGTCTTTGAAAGGAAAGACTTACTGGTTTGCTACAGATGAAAAAGAGAAA
CAACTCGGCTTATTCTTAATCAGTTTTGATCATACAACAGAAAGATTTGAACGTCTATGTCTACCTTATCCGCATCCATA
TCATGGTTATCAAAACGAGTATCTATCTGTTGTTAGAGAAGAGAAACTTTCCGTGTTATTACAACCGGTGGATTTGACGC
CTGAGCCCAAATTTGACATGTTATTGTTGGTCGATGTGGAGAAGAAAGTCCTCGTGTATACTCAAAATAATGGATACAAA
AGCCAAACTATGGTATACATCGTTGGAGAGGACAACAAAGTTAGGGAAGTGGCTTTTGGAGACGCATTCAAACCATTTTT
GTTGAATTATGTTCCAAGTTTGACTCAAATCCAGCAAGGTGATGATTAA