Details for Lyrate rockcress Locus 16051410

Position : sca3 ( 5`- 9776140 .. 9782786 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051410

Protein [Map View]
MSSSKRIVWFPILIVAIQILSIHTVLSQSQNNAFLFHKCSDIEGSFTSKSPYESNLNNLFPQLSYKVPSTGFATSSAGIT
PDNVNGLALCRGDASSSDCSSCLATAIPEIRQRCPSNKAGIIWYDNCLVKYSSTNFFGKIDFENRFYLYNVNNVSDPSTF
NTQTKALLTKLTKKATTGDNQKLFATGEKNIGMKKLYGLVQCTRDLKSEACKACLNGIIGELPNCCDGKEGGRVVGGSCN
FRYEIYPFVNAA*

DNA
ATGTCTTCATCAAAACGGATCGTTTGGTTCCCTATCTTGATCGTAGCCATACAAATTCTCTCTATACATACCGTTTTGTC
CCAAAGCCAGAACAATGCGTTTCTCTTCCACAAGTGCTCAGACATTGAAGGAAGCTTCACTTCGAAAAGTCCCTACGAGT
CAAATCTTAACAATCTCTTTCCTCAGCTCTCTTACAAAGTTCCATCCACCGGTTTTGCCACCTCTTCCGCTGGTATCACT
CCAGACAACGTTAACGGTTTGGCCCTTTGCCGCGGTGATGCCTCTTCCTCTGACTGCAGCTCCTGTCTTGCCACCGCCAT
CCCTGAGATACGTCAGAGATGTCCGAGCAACAAGGCAGGAATAATATGGTATGACAACTGTCTTGTCAAGTATTCCTCCA
CCAATTTCTTCGGGAAGATCGATTTCGAGAACAGGTTCTATTTGTACAACGTCAACAATGTGAGCGATCCATCGACGTTC
AACACGCAGACGAAAGCTCTTCTAACCAAGCTGACAAAGAAAGCGACTACTGGAGATAACCAGAAGCTGTTTGCGACAGG
AGAGAAGAATATCGGGATGAAGAAATTGTACGGACTAGTGCAGTGTACGAGGGACTTGAAGAGTGAGGCTTGTAAGGCAT
GTTTAAATGGAATTATTGGGGAGCTTCCTAACTGTTGCGACGGTAAAGAAGGAGGGAGAGTTGTGGGTGGGAGCTGTAAC
TTTAGGTATGAGATTTACCCTTTTGTTAACGCTGCTTGA