Details for Lyrate rockcress Locus 16051404

Position : sca3 ( 5`- 3566680 .. 3567918 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478210 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16051404

Protein [Map View]
MDNEIAKKVTAIFDHRRLNRSGSSLYTAFASTVIALVVFTIVLVSNLSVRGDFSAKVVTIEIKTVVPYLLPLSSEKEVSD
QGNSNYSIKQQIIVKEIDNNLQVIEDFGGKGVSEKFQERATEFLRDDCEVKFMMTWISPAELFGKREILSVESVFKSHPR
GCLMILSSTMDSPQGFSILKPFLDRGYRVMAVTPDLHFLLKDTAGESWLEEIQTGKRDPGKISLAQNLSNLMRLAYLYKF
GGVYLDTDMIVLKSFKTLRNVIGAQTLEPVSRKWTRLNNAVLIFDKNHPFLLKSIEEFALTFNGNVWGHNGPYLVSRVAR
AVEGTDGYNFTIMTPPAFYPVNWVEIEKLFKVPRTEKDSKRVQVKVLEMQKRSYGLHLWNKFSSKFEIEQGSTMDQLISD
HCIICDSVVSVS*

DNA
ATGGATAATGAAATCGCGAAGAAAGTCACGGCGATATTTGATCACCGGAGGTTAAACCGCTCTGGATCATCACTCTACAC
AGCGTTTGCTTCCACGGTTATAGCTCTGGTCGTTTTCACCATCGTTCTCGTCTCTAATTTATCGGTGAGAGGAGATTTCT
CGGCGAAAGTGGTGACAATAGAGATCAAGACAGTTGTTCCTTACTTATTACCTCTAAGCTCAGAGAAGGAGGTAAGTGAT
CAAGGCAACAGTAACTATTCGATCAAGCAACAAATCATAGTCAAAGAGATTGATAACAATCTTCAAGTTATTGAAGATTT
TGGAGGCAAAGGCGTGTCGGAGAAGTTTCAAGAGAGAGCAACAGAGTTTTTAAGAGATGATTGTGAGGTCAAGTTCATGA
TGACATGGATCTCACCTGCGGAATTGTTCGGTAAGAGAGAGATTTTGTCTGTCGAAAGCGTCTTTAAATCTCATCCTCGA
GGTTGTTTGATGATTTTATCATCCACAATGGATTCTCCTCAAGGGTTTAGTATCTTGAAACCGTTTCTTGATCGAGGTTA
CAGAGTAATGGCGGTCACACCGGATTTGCATTTTCTTCTCAAGGACACAGCCGGAGAATCATGGCTTGAAGAGATTCAGA
CAGGTAAAAGAGATCCCGGAAAGATCTCTCTAGCTCAAAATCTATCAAACCTCATGCGACTCGCTTATCTGTATAAATTC
GGAGGTGTTTATTTAGACACGGACATGATTGTTTTAAAGAGCTTTAAAACTCTTAGGAACGTGATCGGTGCACAGACTCT
CGAACCGGTTTCGAGAAAGTGGACAAGATTGAACAATGCGGTTTTGATCTTCGACAAGAATCATCCTTTCTTGCTCAAAT
CCATTGAAGAATTCGCGTTGACTTTTAATGGAAACGTTTGGGGTCATAACGGACCGTATCTTGTTTCTCGAGTGGCTCGA
GCCGTGGAAGGAACCGATGGCTATAACTTTACCATCATGACACCTCCTGCGTTTTATCCAGTGAATTGGGTTGAGATTGA
GAAGCTATTCAAGGTTCCAAGAACCGAGAAAGATTCAAAGAGGGTTCAAGTCAAGGTTCTTGAAATGCAAAAGAGAAGCT
ATGGATTGCATTTGTGGAATAAGTTTAGCAGTAAATTTGAAATTGAACAAGGAAGTACCATGGATCAACTAATTTCAGAT
CACTGTATAATCTGTGATAGTGTTGTCTCTGTATCGTGA