Details for Lyrate rockcress Locus 16051393

Position : sca3 ( 5`- 8876984 .. 8875426 -3` )
Annotation : [B2G] chloroplast aspartate carabmoyltransferase
External links : CoGe
PGDD synteny : 16051393

Protein [Map View]
MSIASSLSSATLCGASVFPKALGYSSEFPSNLPSPSESSKICLTSFPASRDPKKNATWNLTRNVGPIQGIRCHAMQAGTR
ELKKFELSDVIEGKQFDREMLSAIFDVAREMEKIEKSSSQSEILKGYLMATLFYEPSTRTRLSFESAMKRLGGEVLTTEN
AREFSSAAKGETLEDTIRTVEGYSDIIVMRHFESGAARKAAATANIPVINAGDGPGEHPTQALLDVYTIQSEIGKLDGIS
VALVGDLANGRTVRSLAYLLAKFKDVKIYFVSPEIVKMKDDIKDYLTSNGVEWEESSDLMEVASKCDVVYQTRIQRERFG
ERLDLYEAARGKYIVDKDLLGVMQKKAIIMHPLPRLDEITADVDADPRAAYFRHADPRAAYFRQAKNGLFIRMVHGR*

DNA
ATGTCTATTGCGTCATCACTTTCTTCAGCCACACTTTGCGGCGCCTCAGTTTTTCCTAAAGCATTAGGCTACAGCTCTGA
GTTCCCAAGCAATCTTCCCAGTCCTTCTGAAAGTTCAAAGATTTGTTTGACTTCATTTCCTGCCTCTAGGGATCCCAAGA
AAAATGCTACTTGGAATCTAACCCGAAATGTTGGTCCGATCCAAGGAATCAGGTGTCATGCTATGCAAGCTGGGACGAGG
GAATTGAAGAAATTTGAACTTAGTGATGTGATTGAAGGGAAACAATTTGATAGGGAGATGCTAAGCGCTATATTCGATGT
TGCACGAGAAATGGAAAAGATAGAAAAGAGCTCTTCCCAAAGTGAAATTCTCAAGGGTTATTTAATGGCTACCCTCTTTT
ATGAGCCTTCTACCCGTACCAGGCTTTCATTTGAATCTGCCATGAAACGCCTTGGAGGTGAAGTCTTAACTACTGAGAAC
GCTAGAGAGTTTTCGTCTGCCGCGAAAGGGGAAACACTTGAAGACACAATAAGAACAGTGGAGGGTTATTCAGATATAAT
TGTGATGCGACATTTTGAAAGCGGTGCTGCAAGAAAAGCTGCAGCTACTGCCAATATACCTGTCATTAATGCAGGTGATG
GTCCTGGAGAGCATCCTACTCAGGCTCTATTGGACGTCTATACCATCCAAAGTGAAATTGGAAAATTAGATGGCATCAGT
GTAGCCTTAGTTGGAGATCTTGCCAACGGAAGGACAGTCCGGTCTCTGGCATACTTGCTTGCCAAGTTTAAAGACGTGAA
GATCTACTTTGTTTCCCCTGAAATTGTGAAAATGAAGGATGATATAAAAGACTACTTGACATCAAACGGGGTCGAATGGG
AAGAAAGTTCAGATTTAATGGAAGTAGCATCCAAGTGTGATGTAGTTTATCAAACCCGAATCCAAAGAGAGAGGTTTGGA
GAAAGGCTTGACCTTTACGAAGCAGCTCGTGGGAAGTATATCGTAGACAAGGATCTGTTAGGAGTAATGCAGAAAAAAGC
TATTATCATGCATCCTTTACCGAGATTGGATGAAATCACTGCAGATGTTGATGCTGATCCAAGAGCTGCCTACTTCAGAC
ATGCTGATCCAAGAGCTGCCTACTTCAGACAAGCAAAGAACGGTTTGTTCATTAGAATGGTTCATGGTCGTTAA