Details for Lyrate rockcress Locus 16051392

Position : sca3 ( 5`- 9521215 .. 9522786 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051392

Protein [Map View]
MNLEEHLSLGEFHVSNLIKNHISRGSPIQALVLYGGIRRRGVYFPGWVPLILKACACVVPRVVLGKLLHSESIKFGVCSD
VMVGSSLISMYGKWGCVVSARKVFDEMPERNVATWNAMIGGYMGNGDAVSASGLFEEISVCRNTVTWIEMMKGYGKRKEI
EKARELFERMPFELKNVKAWSVMLGVYVSHRKMEDARKFFEDIPEKNSFVWSLMISGYFRIGDVHEATSVFYRVFARDLV
IWNTLITGYAQNGYSGDAIDAFYNMQGEGYEPDAVTVSSVLSACAQSGRLDVGREVHSLINRKGIELNQFVSNALIDMYA
KCGDLENATSVFESLSLRSLACWNSMISCLAIHGKGNEALEMFRTMGSLDLKPDEITFLAVLTACVHGGFLMEGLKIFSE
MKTQDVKPNVKHFGCLIHLLGRSGKLKEAYRLVREMPVKPNDTVLGALLGACKVHMDTEIAEQVMKIIVTVGSITNSDCE
NHLASISNLYAHTERWETAEALRVEMEKRGLEKSPGLSSVVLT*

DNA
ATGAATTTGGAGGAACATTTATCGTTAGGTGAGTTTCATGTGTCGAATCTTATAAAGAATCATATATCTAGAGGATCACC
AATACAAGCTCTAGTTTTGTACGGAGGAATCCGCCGCAGAGGAGTGTATTTTCCGGGATGGGTTCCTTTGATTTTAAAGG
CATGTGCTTGCGTTGTTCCACGTGTTGTTCTTGGGAAGCTGTTACATTCTGAATCGATCAAGTTCGGTGTTTGTTCTGAT
GTTATGGTGGGAAGCTCTCTGATCAGTATGTATGGGAAATGGGGATGTGTAGTTTCTGCACGTAAGGTGTTTGACGAAAT
GCCTGAGAGAAACGTAGCTACTTGGAACGCTATGATTGGTGGGTATATGGGTAATGGGGATGCAGTTTCGGCTAGTGGAT
TGTTCGAAGAGATATCGGTTTGTAGAAATACGGTGACTTGGATCGAGATGATGAAAGGGTATGGTAAGAGAAAAGAGATT
GAGAAAGCTAGAGAATTGTTTGAGAGAATGCCTTTTGAGTTGAAGAATGTGAAGGCTTGGTCAGTGATGCTCGGAGTTTA
CGTTAGTCATCGAAAAATGGAGGATGCAAGGAAGTTTTTCGAGGATATACCGGAGAAGAACTCCTTTGTATGGTCATTGA
TGATCTCCGGGTATTTCAGGATAGGTGATGTGCATGAGGCTACAAGTGTTTTTTATCGAGTTTTTGCTCGTGATTTGGTG
ATTTGGAACACTTTGATCACTGGTTATGCACAGAATGGGTATTCTGGTGATGCTATTGATGCTTTCTATAATATGCAAGG
AGAAGGGTATGAACCCGATGCGGTAACGGTTTCAAGTGTTTTATCTGCTTGTGCTCAGTCAGGCCGTCTTGATGTTGGCA
GAGAAGTTCACTCTCTGATTAACCGTAAAGGAATTGAGCTTAATCAGTTTGTTTCAAATGCGTTGATTGATATGTATGCT
AAATGTGGGGATCTAGAGAATGCGACATCCGTGTTTGAGTCGTTAAGTCTGAGAAGTTTAGCGTGTTGGAACTCTATGAT
CTCTTGTCTTGCCATTCATGGGAAAGGCAACGAAGCTTTAGAGATGTTCAGAACAATGGGGAGCTTAGATTTAAAGCCTG
ACGAGATCACTTTTCTGGCGGTTCTCACTGCTTGTGTCCATGGAGGCTTTCTAATGGAAGGTCTAAAGATATTCTCGGAG
ATGAAAACTCAAGACGTGAAACCGAATGTAAAGCATTTTGGATGTTTGATACATCTATTGGGACGCTCCGGAAAACTGAA
AGAAGCTTACAGATTGGTAAGAGAAATGCCTGTGAAACCGAATGATACAGTATTGGGAGCTTTACTTGGTGCATGTAAGG
TTCATATGGATACAGAAATAGCTGAACAAGTGATGAAGATCATCGTGACTGTGGGAAGCATCACTAACAGTGACTGCGAG
AACCATCTTGCGTCGATATCGAACTTGTATGCACACACCGAGAGATGGGAAACAGCTGAAGCATTGAGAGTAGAAATGGA
GAAAAGAGGTCTTGAGAAATCCCCAGGGCTTAGCTCAGTAGTTTTGACCTGA