Details for Lyrate rockcress Locus 16051383

Position : sca3 ( 5`- 9354204 .. 9355960 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479637 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16051383

Protein [Map View]
MDELHGNNGRMHIGVAQDPMHVQYDHHGLHHIDNGNGMMDEHTDGGMDEGVETDIPSHPGNSADNRGEVVDRGIENGDQL
TLSFQGQVYVFDRVSPEKVQAVLLLLGGREVPQTLPTSLGSPHQINRVLGLSGTPQRLSVPQRLASLLRFREKRKGRNFD
KTIRYTVRKEVALRMQRKKGQFTSAKSSNDDSGSTGSDWGSNQNWAIEGTETQKPEVLCRHCGISEKSTPMMRRGPDGPR
TLCNACGLMWANKGTLRDLSKVPPPQTPQHLPLNKNEDPNLEADQMNGVADDISNSQ*

DNA
ATGGATGAACTTCATGGAAACAATGGTCGTATGCACATTGGCGTAGCGCAAGATCCAATGCATGTGCAGTATGATCATCA
CGGCTTGCACCATATCGACAATGGAAACGGTATGATGGATGAACATACTGATGGTGGGATGGATGAAGGAGTGGAGACAG
ACATTCCTTCTCACCCTGGAAACTCAGCTGATAATCGCGGTGAAGTTGTAGACCGTGGTATCGAAAATGGAGATCAATTG
ACATTGTCATTCCAGGGACAAGTTTATGTTTTTGACCGTGTCTCGCCTGAGAAGGTTCAAGCTGTCCTTTTGTTACTTGG
TGGACGTGAAGTACCCCAGACACTCCCGACATCCCTAGGATCACCTCATCAGATCAATAGGGTACTGGGTCTATCTGGTA
CTCCTCAACGGCTTAGCGTCCCGCAGCGGTTAGCTTCTTTGCTCAGATTTAGGGAGAAACGAAAAGGGAGGAATTTTGAT
AAGACAATTCGCTACACTGTGAGGAAAGAGGTAGCCTTGAGAATGCAACGTAAGAAAGGACAGTTCACATCGGCTAAATC
AAGCAATGATGATTCTGGATCCACTGGATCGGATTGGGGGTCAAACCAGAACTGGGCCATAGAAGGGACTGAGACTCAGA
AGCCAGAGGTTTTATGTCGACACTGTGGAATAAGTGAGAAGTCAACTCCAATGATGCGACGTGGACCTGATGGGCCAAGA
ACACTTTGTAATGCATGTGGACTAATGTGGGCAAACAAGGGAACTCTTAGAGACTTGTCCAAAGTCCCTCCTCCTCAAAC
ACCTCAGCATCTACCTCTGAATAAGAATGAGGATCCAAATCTTGAGGCTGATCAAATGAATGGAGTAGCTGATGACATTA
GCAACTCACAGTGA