Details for Lyrate rockcress Locus 16051373

Position : sca3 ( 5`- 1918746 .. 1920867 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477808 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16051373

Protein [Map View]
MANEDDDGEKSRSLHQQIAKKPKTQIIIGVPSYQEVIESSQTKSTPPSLFKPSQSFSQAFAFVKSSDVYSPPPSSSAASS
SSQPPGASQVPNSSQPLQTDGASSSSTPVATGSLPSNTTQTRNAILVSHRQKGNPLLKHIRNVKWVFSDIIPDYVLGQSS
CALYLSLRYHLLHPDYLYFRIRELQKNFKLSVVLCHVDVEDTVKPLLEVTKTALLHDCTLLCAWSMTECARYLETIKVYE
NKPADLIQGQMDTDYLSRLNHSLTSIRHVNKSDVVTLGSTFGSLAHIIDASMEDLARCPGIGERKVRRLYDTFHEPFKRA
TSSYPSVVEPTIPEAPVQKNVSSKEPVVEDEDFVEDSRKRKKKEPEKTVKTALSAVFARYSDKLSKKKEKQKEKDATTES
DAEIHQD*

DNA
ATGGCGAACGAAGACGACGACGGTGAGAAATCCAGAAGTCTTCACCAACAGATTGCTAAAAAACCCAAAACCCAGATCAT
AATTGGTGTGCCATCGTACCAGGAAGTTATAGAAAGCTCACAGACGAAGTCCACGCCTCCATCTCTCTTCAAGCCTTCCC
AGAGTTTCTCTCAGGCATTCGCTTTCGTCAAATCGTCCGACGTCTACTCTCCTCCTCCGTCTTCCTCCGCCGCCTCTTCT
TCTTCGCAGCCGCCGGGCGCTTCTCAGGTGCCCAATTCAAGCCAACCGCTTCAAACCGATGGTGCCTCATCTTCTTCTAC
TCCTGTAGCTACTGGCTCTTTACCGTCAAACACAACTCAAACTCGTAACGCAATCCTCGTTAGCCATAGACAGAAAGGAA
ACCCGCTTCTTAAACATATCAGGAATGTGAAATGGGTTTTCTCAGATATCATTCCAGATTACGTGCTTGGTCAAAGCTCT
TGCGCTTTGTATTTAAGCTTGCGGTATCATCTGCTACATCCGGATTACCTCTATTTCCGCATTAGGGAACTACAAAAGAA
TTTCAAGCTAAGTGTTGTTCTTTGCCATGTCGACGTGGAAGATACGGTGAAACCGTTGCTTGAAGTCACGAAAACCGCTC
TACTTCATGATTGCACTCTATTGTGCGCCTGGAGCATGACGGAATGTGCCCGTTATTTGGAAACAATAAAAGTCTATGAA
AACAAACCCGCAGATCTCATCCAAGGCCAAATGGATACAGATTATCTATCACGGCTAAACCATTCTCTTACAAGCATTCG
ACATGTAAACAAGAGCGATGTAGTTACACTTGGTTCTACATTCGGGTCTCTTGCCCATATAATTGATGCATCCATGGAAG
ATTTAGCACGTTGTCCAGGGATTGGCGAACGTAAGGTTAGGCGGTTGTATGATACATTCCACGAGCCTTTCAAGCGTGCA
ACTTCAAGCTACCCGTCTGTTGTAGAACCAACAATCCCAGAAGCTCCAGTTCAGAAGAATGTGAGCTCAAAGGAACCTGT
TGTAGAAGATGAGGATTTTGTGGAGGACTCTAGAAAACGCAAGAAGAAAGAGCCCGAGAAAACTGTGAAGACCGCGCTCT
CAGCTGTTTTTGCTCGTTACTCTGATAAACTTAGCAAGAAAAAAGAGAAGCAAAAGGAGAAAGATGCAACAACCGAGTCA
GATGCTGAAATCCACCAAGATTAA