Details for Lyrate rockcress Locus 16051362

Position : sca3 ( 5`- 1669945 .. 1669379 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896527 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16051362

Protein [Map View]
MADPTNPSTGDQQHQKYRQYNPYQQVNLPYRQLYELPTSPEFLFEEEATKKRLTWGENLTFFTGWGYVTGSVLGAVKGTI
NGIGAAERGESLKIRTNRILNSGGLVARRGGNCLGSIGLMFAAMESGVTYLRDGDDGSRTTVIAGLATGVLYRAASGPRS
AVVAGAVGGVTALAAVAGRRIVKRFVPI*

DNA
ATGGCGGATCCGACGAACCCTAGCACCGGCGATCAACAACACCAGAAGTACCGTCAGTACAATCCCTACCAACAAGTCAA
TCTTCCGTACCGTCAGCTATACGAACTCCCAACTTCGCCGGAGTTTCTCTTCGAAGAAGAAGCTACGAAAAAACGCTTAA
CATGGGGAGAGAACCTCACCTTCTTCACCGGTTGGGGTTATGTCACTGGATCGGTTCTCGGAGCCGTCAAGGGTACAATT
AATGGGATCGGAGCCGCCGAAAGAGGCGAATCCCTAAAGATCCGAACTAATCGGATTTTGAACTCCGGTGGACTCGTTGC
AAGACGCGGCGGGAATTGCTTAGGATCTATAGGGTTGATGTTCGCAGCTATGGAGAGTGGTGTTACGTATTTGAGAGACG
GAGACGACGGTTCGAGGACAACTGTCATCGCTGGTTTAGCCACTGGTGTGCTTTACAGAGCTGCTTCTGGACCTAGATCC
GCTGTGGTTGCCGGAGCTGTCGGAGGAGTTACTGCTTTGGCTGCGGTTGCTGGGAGACGCATCGTCAAGCGATTCGTTCC
AATCTGA