Details for Lyrate rockcress Locus 16051358

Position : sca5 ( 5`- 17868478 .. 17867904 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051358

Protein [Map View]
MTLQSMKRYPPTMAEPPYHSYGSQGQEHPKTTSAPIPLFLRPSRRLRRTTLPRFCRHRRDKASDLRRSNHGSKKTTSSSF
SWSSTSSSSSFSSSPPHSLKKRASHDKKSPLLYANYGEDELRSSPTSTLRYSKGGRIGCSSSMGNLTRALFPGSMENMKR
NGTTGKALIISDMNKA*

DNA
ATGACTTTGCAATCGATGAAGAGATATCCTCCTACTATGGCGGAGCCTCCATACCATTCATATGGGAGTCAAGGCCAGGA
ACACCCAAAAACCACCTCTGCTCCGATTCCTCTCTTCCTCCGCCCCTCACGCCGCCTCCGTCGTACTACTCTTCCGAGAT
TTTGTCGACACCGAAGAGACAAAGCAAGCGATCTCAGGAGGAGCAATCACGGTAGCAAGAAGACGACCAGCTCATCGTTT
TCTTGGTCTTCTACGTCATCTTCATCTTCCTTTTCCTCCTCGCCACCACATTCTTTGAAAAAACGAGCGAGTCATGACAA
AAAATCACCACTTCTGTACGCGAACTACGGAGAGGATGAGCTTAGGTCGTCACCAACCTCGACTCTGCGTTACTCCAAGG
GGGGGCGAATTGGGTGTAGTTCTTCAATGGGGAATCTGACAAGAGCTCTGTTCCCTGGATCAATGGAGAATATGAAGAGA
AACGGGACCACTGGTAAAGCTCTAATCATCAGCGACATGAATAAAGCTTGA