Details for Lyrate rockcress Locus 16051338

Position : sca3 ( 5`- 5617140 .. 5618889 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478773 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16051338

Protein [Map View]
MVILSASSTVRAALDTQPRLPYNPNAPRKVKKTPNNNSFLPPPSPPPSPGISISVADLLKRPASKELTVDVDDTYMGYET
WSPSPPKLEKPRSVFNAASLAFIGDSIFELYARRHFLFPPLSIEDYNDRVRAVVRCEAQYALLKKLVDDDFLTKEERDIL
RWGKNLGSARTRTRRRAGNAVYNKASSLETLIGYLYLTNGKRLEKIMQKLGFSSDSSTEIVIEEAKPKPSESNLSNFILN
EQVVS*

DNA
ATGGTGATTTTATCGGCGAGCTCCACCGTGAGAGCTGCCTTAGATACACAACCTAGACTTCCGTACAACCCTAATGCGCC
GCGAAAAGTTAAGAAAACCCCTAACAATAATTCATTCTTACCACCACCGTCACCTCCACCGTCTCCAGGAATCAGCATCT
CCGTCGCTGATTTGCTCAAGCGTCCCGCAAGTAAAGAATTAACTGTTGACGTTGATGATACGTATATGGGATATGAGACA
TGGTCTCCAAGTCCACCAAAGTTGGAGAAACCAAGATCAGTCTTCAATGCTGCTTCTTTGGCCTTCATAGGCGATTCCAT
TTTTGAGCTATATGCTCGTAGGCATTTTCTTTTCCCTCCGCTCAGTATTGAAGATTATAACGATCGTGTTAGAGCAGTGG
TGCGCTGTGAAGCACAGTATGCTTTGCTGAAGAAACTTGTTGATGATGACTTCTTAACAAAGGAAGAGAGGGATATTCTT
AGGTGGGGAAAAAATCTAGGTTCCGCTAGAACACGTACAAGAAGGCGTGCAGGTAATGCGGTTTATAACAAGGCATCATC
ATTGGAGACACTAATTGGTTATCTGTATCTGACAAACGGGAAGAGATTAGAGAAAATAATGCAGAAGCTAGGATTCTCAA
GCGACTCTTCAACTGAGATCGTGATTGAAGAGGCCAAGCCCAAACCATCAGAATCCAACCTCTCAAACTTCATACTCAAC
GAGCAAGTGGTGTCATAA