Details for Lyrate rockcress Locus 16051297

Position : sca3 ( 5`- 5287679 .. 5286510 -3` )
Annotation : [B2G] AtSerat2_2 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16051297

Protein [Map View]
MFPVTSRRHFSMSLYMLRSSSPHINHHSFLLPSFVSSSTFSPIKDQPLSPPPPMAACIDTCRTGEPQISPRDSSKNHDDE
SGFRYMNYFRYPDRASFNGTQTKTLHTRPLVEDLDRDAEIDDVWAKIREEAKSDIAKEPIVSGYYHASIVSQRSLEAALA
NTLSVKLSNLNLPSNTLFDLFSGVLQENPEIVESVKQDLLAVKERDPACISYVHCFLHFKGFLACQAHRIAHELWTQDRK
ILALLIQNRVSEAFAVDFHPGAKIGTGILLDHATAIVIGETAVVGNNVSILHNVTLGGTGKQCGDRHPKIGDGVLIGAGT
CILGNITIGEGAKIGAGSVVLKDVPPRTTAVGNPARLLGGKDNPKTHDKIPGLTMDQTSHISEWSDYVI*

DNA
ATGTTCCCGGTCACAAGTCGGCGCCATTTCTCAATGTCCCTATATATGCTCCGTTCATCTTCTCCACACATCAATCATCA
CTCTTTCCTTCTTCCTTCTTTTGTTTCCTCCTCCACTTTCTCTCCTATCAAAGACCAACCTTTATCTCCTCCTCCTCCTA
TGGCTGCGTGCATCGACACCTGCCGTACTGGTGAACCCCAGATTTCTCCTCGCGATTCTTCTAAAAACCACGATGATGAG
TCTGGCTTTCGTTACATGAATTACTTCCGTTACCCTGATCGAGCTTCCTTCAATGGAACCCAGACGAAAACCCTCCATAC
TCGTCCCTTGGTTGAAGATCTCGATCGCGACGCTGAAATCGATGATGTTTGGGCCAAAATCCGAGAAGAAGCTAAATCTG
ATATCGCCAAAGAACCTATTGTTTCCGGCTATTATCACGCTTCGATTGTGTCCCAGAGATCGTTGGAAGCTGCGTTGGCC
AATACTTTATCTGTTAAACTCAGCAATTTGAATCTTCCGAGCAACACGCTTTTCGATTTGTTCTCCGGTGTTCTTCAAGA
GAACCCAGAAATTGTTGAATCTGTGAAACAAGATCTGTTAGCTGTTAAGGAGAGAGATCCAGCTTGTATAAGCTACGTTC
ATTGTTTCCTTCACTTTAAAGGCTTCCTCGCTTGTCAAGCGCATCGTATTGCTCATGAGCTTTGGACGCAGGACCGAAAA
ATCCTAGCTTTGTTGATTCAGAACAGAGTATCTGAAGCCTTCGCTGTTGATTTCCACCCTGGAGCTAAAATTGGAACCGG
GATTTTGCTAGACCACGCTACGGCTATCGTGATCGGCGAGACGGCGGTTGTGGGGAACAATGTTTCGATTCTCCACAACG
TTACACTTGGAGGGACGGGGAAACAGTGTGGAGATAGGCACCCGAAGATTGGCGATGGTGTTTTGATTGGAGCTGGGACT
TGTATTTTGGGGAATATTACGATTGGAGAAGGAGCTAAGATTGGTGCTGGCTCGGTGGTGCTGAAAGACGTGCCGCCGCG
TACGACGGCTGTTGGAAATCCGGCGAGGTTGCTTGGTGGTAAAGATAATCCGAAAACGCACGACAAGATTCCTGGTTTGA
CTATGGACCAGACATCGCATATATCCGAGTGGTCGGATTATGTAATTTGA