Details for Lyrate rockcress Locus 16051279

Position : sca3 ( 5`- 4455834 .. 4456325 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051279

Protein [Map View]
MRGHEPRSSSSCAACKLLKRRCTPTCIFAPYFRSSDLITFAKVHKVFGASNVSKLLGEVPEEQRQETVNSLAYEAEVRLK
DPVYGCIGAIASLQKKMLELQHDLAVARTRLLAHSGVTNQVSPLDDSPELAAFLDLVPYSDLMLLDGSSLDAYLYDLGQP
PFV*

DNA
ATGAGAGGGCATGAGCCACGATCAAGCTCATCTTGTGCAGCCTGCAAGCTCTTGAAGAGACGATGCACACCCACTTGCAT
TTTCGCTCCTTATTTCCGCTCAAGTGACTTGATAACTTTCGCCAAAGTCCATAAAGTCTTTGGAGCCAGCAACGTCAGTA
AGCTTCTCGGTGAGGTCCCTGAAGAACAGAGACAAGAAACCGTTAACTCCTTGGCTTATGAAGCTGAGGTTCGTCTCAAG
GATCCTGTTTACGGTTGCATTGGAGCCATAGCGTCTCTGCAGAAGAAGATGCTCGAGCTTCAACATGATCTAGCCGTTGC
TCGCACTCGACTACTTGCCCATTCTGGGGTCACCAACCAAGTGTCCCCTTTGGATGATTCTCCTGAGCTTGCTGCTTTTC
TTGATCTTGTACCTTACAGTGACTTGATGTTGCTTGATGGGTCTAGTCTTGATGCTTACTTGTATGATCTTGGACAGCCT
CCTTTTGTATAG