Details for Lyrate rockcress Locus 16051269

Position : sca3 ( 5`- 6460624 .. 6461793 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051269

Protein [Map View]
HPDHEVHPEHMVKPDHKLQSMLGALEHPEHTVKPNHKLQSMLGESEHPEHKVKPDHKLQSMLGEHLEHKEKPDHKLQSMS
GVSEHPEHKVKPDHKLQSLLGESEHPEHKVKPDHKLQSMSGESKHPAHKIKPDQIMQTMASELEEEDPDHTTKPMGYGVG
RGYGSGGSGVGYGVGIGSSGGSGFGEGTGSSGGIGFGEGIGSSGGSGFGEGIGSSGGSGFGEGIGSSGGSGFGEGIGSGG
GTGIGIGEGIGSGSGQPNCGPVTGAPGEGIGIGIGQGSSGGPGVVVPGATIPPIVVPGAQIPGFTIPGITVPGYGSGCQT
GGCNPYPPHYYNPPSCPHCPPFTSGEDKHMSDKGAMTEALAPTTPEMHV*

DNA
CACCCAGATCATGAGGTACATCCTGAGCACATGGTCAAGCCTGACCATAAACTGCAGTCCATGTTGGGTGCATTAGAACA
TCCTGAGCACACGGTCAAGCCTAACCATAAACTCCAGTCTATGTTGGGTGAATCAGAACATCCTGAGCACAAGGTCAAGC
CTGACCATAAACTCCAGTCCATGTTGGGAGAACATCTTGAGCACAAGGAAAAGCCTGACCATAAACTCCAGTCCATGTCG
GGTGTATCAGAACATCCTGAGCACAAGGTCAAGCCTGACCATAAACTCCAGTCTTTGTTAGGTGAATCAGAACATCCTGA
GCACAAGGTCAAGCCTGACCATAAACTGCAGTCCATGTCTGGTGAATCAAAACATCCTGCGCACAAAATCAAGCCTGATC
AGATAATGCAGACCATGGCGAGTGAACTGGAAGAGGAAGATCCAGACCACACAACTAAGCCTATGGGATATGGTGTAGGT
AGGGGCTACGGAAGTGGTGGGTCTGGTGTTGGCTATGGCGTTGGAATTGGCTCTAGTGGAGGGAGTGGCTTTGGGGAAGG
AACTGGCTCTAGTGGAGGCATTGGCTTTGGAGAAGGTATTGGCTCTAGTGGAGGCAGTGGCTTTGGAGAAGGTATTGGCT
CTAGTGGAGGCAGTGGCTTTGGAGAAGGAATTGGGTCTAGTGGTGGCAGCGGCTTTGGTGAAGGAATTGGGTCTGGTGGT
GGTACAGGTATTGGCATTGGAGAAGGAATAGGATCCGGGTCTGGCCAACCCAATTGCGGTCCAGTCACGGGAGCTCCAGG
CGAAGGGATTGGTATCGGAATAGGACAGGGCTCTAGTGGTGGACCCGGTGTAGTTGTCCCAGGCGCAACAATCCCTCCCA
TAGTAGTTCCAGGCGCACAGATTCCCGGTTTTACGATTCCAGGTATCACAGTTCCTGGCTACGGTTCTGGGTGCCAAACA
GGTGGTTGCAATCCGTACCCACCACACTACTATAACCCACCAAGCTGTCCACATTGTCCACCTTTCACATCAGGAGAAGA
CAAGCACATGTCAGACAAAGGAGCAATGACGGAAGCTCTTGCACCCACTACACCGGAGATGCATGTTTAA