Details for Lyrate rockcress Locus 16051225

Position : sca2 ( 5`- 16437134 .. 16439957 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_476615 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16051225

Protein [Map View]
MTLHRSLVFFFLFLSCFSLSSWALPLCSDSRAPSEVNSTLSFCPYKGKTCCNSMEDSSLMKQFQAMNISDKGCASVVKSI
LCAKCDPFSSDLFRDNSDQQSVPILCNSTSSANSTEDFCSETWETCQNVSISGSLFAASLQGRAGAPANNNASKLADVWQ
SKTDFCSAFGGASSNETVCFSGEPVALTDNDTTPDKPPSGLCLEKIGNGSYLNMVPHPDGSNRAFFSTQPGIVFLAGIPD
QDSGGVLDVDPSSPFVDLTDEIHFDTEFGMMGMAFHPKFAQNGRYFASFNCDKSKWPGCTGRCSCNSDVNCDPSKLTPDS
GSQPCQFQTVIAEYTANGTSSDPSKAKNAKPTEVRRIFTMGLPFTSHHAGQILFGPDGYLYFMMGDGGGGADPYNFSQNK
KSLLGKIMRLDVDNIPSASEISKMGLWGNYSIPKDNPFREDKELEPEIWAIGLRNPWRCSFDSSRPSYFMCADVGQDTYE
EVDLITKGGNYGWRVYEGPDLFQPEASPGGNTSIKSLNPIFPVMGYNHSEVDSSGKSASITGGYFYRSETDPCIAGMYVY
ADLYGNGVWAGIETPANSGNFVTNRTTFSCAGDSPMKCSDSPGTSGLSLGYVFSFGEDNNKDIYLLTSNGVYRVVRPSRC
NLTCSKENSTAARRKPGPSSSPSSSPSSCYKHINGFHGSFVVLFVSLSLILLGLLN*

DNA
ATGACGCTTCATCGATCTCTTGTGTTCTTTTTCTTGTTCCTCTCATGTTTCTCTCTTTCTTCATGGGCTCTTCCTCTCTG
TTCCGATTCAAGAGCTCCCTCGGAGGTGAATTCGACATTGAGCTTTTGTCCTTACAAAGGAAAAACATGCTGCAATTCAA
TGGAAGATTCCAGTTTGATGAAGCAATTTCAAGCTATGAACATTTCCGACAAGGGTTGTGCTTCTGTTGTAAAATCAATC
CTTTGTGCTAAATGCGATCCTTTTTCATCGGATTTATTCAGAGATAACTCAGATCAGCAGTCTGTTCCAATCCTCTGCAA
CTCTACCAGTTCAGCAAATTCCACAGAGGATTTTTGCTCTGAGACATGGGAGACATGTCAAAACGTTTCCATATCGGGTT
CTCTTTTCGCTGCCTCATTGCAAGGCCGAGCTGGAGCCCCAGCAAATAACAATGCCTCCAAGCTTGCTGATGTATGGCAG
TCCAAAACCGATTTCTGTAGTGCCTTTGGTGGAGCTAGCTCCAATGAAACTGTTTGCTTCAGCGGTGAGCCAGTTGCTCT
TACTGACAATGACACTACTCCTGACAAGCCGCCTTCTGGTTTATGCCTTGAGAAAATCGGGAATGGTTCTTACCTCAACA
TGGTTCCCCACCCTGATGGCTCCAACCGTGCATTCTTCTCTACGCAACCTGGAATAGTATTCTTGGCTGGTATACCGGAT
CAAGATTCTGGCGGGGTATTGGACGTGGATCCATCTAGCCCGTTTGTGGATTTGACTGATGAGATTCATTTTGATACTGA
GTTTGGGATGATGGGAATGGCTTTTCATCCAAAGTTTGCTCAAAATGGGCGGTATTTCGCTTCTTTTAACTGTGATAAGT
CCAAGTGGCCGGGCTGTACTGGAAGGTGCTCATGTAACTCCGATGTGAACTGTGATCCTTCCAAACTAACTCCTGACAGT
GGATCTCAACCTTGCCAATTCCAAACCGTAATAGCTGAGTATACAGCCAATGGTACCTCATCAGACCCTTCTAAGGCAAA
GAATGCTAAGCCAACAGAAGTCAGGAGGATTTTCACAATGGGACTTCCCTTCACATCACACCATGCTGGACAGATTCTCT
TTGGTCCAGATGGGTATCTATACTTTATGATGGGAGATGGAGGTGGAGGCGCAGACCCATACAATTTCTCACAGAACAAG
AAATCTTTGCTAGGAAAGATCATGAGGCTTGATGTAGATAACATTCCTAGTGCTTCTGAGATCTCCAAAATGGGTCTATG
GGGAAACTACTCTATACCAAAAGACAACCCTTTTCGTGAAGACAAAGAGCTTGAACCTGAAATATGGGCTATTGGATTGA
GAAACCCTTGGAGATGCAGCTTTGATTCTTCTAGGCCTTCTTACTTTATGTGTGCTGATGTTGGACAGGACACATATGAA
GAGGTGGATCTCATTACCAAAGGAGGAAACTACGGTTGGCGTGTTTACGAAGGCCCGGATCTTTTCCAGCCGGAGGCATC
CCCCGGAGGAAACACATCTATTAAATCATTAAACCCAATATTTCCTGTGATGGGTTACAACCACTCTGAAGTTGACTCAA
GCGGAAAATCAGCTTCAATCACTGGAGGGTACTTTTATAGATCTGAGACTGATCCTTGCATAGCTGGAATGTATGTGTAT
GCTGATCTATATGGAAATGGCGTGTGGGCGGGGATTGAAACTCCTGCTAATAGCGGGAACTTTGTGACCAACAGAACAAC
CTTCAGCTGCGCCGGTGACTCACCCATGAAATGCAGCGATTCTCCGGGAACTTCAGGGTTATCTCTAGGATATGTCTTCT
CCTTTGGTGAGGATAACAACAAAGACATCTACTTGCTTACAAGCAATGGTGTCTATAGAGTGGTTAGGCCGAGCCGTTGC
AACTTGACTTGCTCCAAGGAAAACTCCACGGCAGCTAGAAGAAAACCCGGTCCCTCGAGTTCTCCTTCTTCTTCGCCGTC
CTCTTGTTATAAGCATATAAATGGTTTCCATGGAAGCTTCGTGGTTTTATTTGTGTCTCTGTCTTTGATTCTGCTAGGTT
TATTAAACTAG