Details for Lyrate rockcress Locus 16051217

Position : sca3 ( 5`- 4415563 .. 4415892 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051217

Protein [Map View]
MRVLTGGVSPSSSSFEFVPLSVVSFGSTVIAEGCDAATSISWIHAWTVANGIITQVREYSNTSLTVTRIGNVVAGRRSAE
IAPSHCPSVWESQFSGRAGKSVPGLVLAI*

DNA
ATGCGCGTACTCACCGGAGGAGTCTCTCCGTCTTCTTCCTCGTTCGAATTCGTACCTCTCTCCGTCGTTTCGTTCGGATC
TACCGTAATCGCAGAAGGCTGCGACGCCGCGACCTCGATTTCTTGGATCCACGCTTGGACCGTAGCGAATGGGATAATCA
CACAGGTGAGGGAGTACTCTAACACTTCTCTCACCGTCACGCGGATCGGTAACGTTGTTGCTGGACGACGCTCCGCTGAG
ATTGCGCCGTCGCATTGCCCCTCCGTGTGGGAAAGCCAATTCTCGGGTCGGGCAGGTAAATCCGTACCCGGTTTGGTTCT
GGCGATTTGA