Details for Lyrate rockcress Locus 16051136

Position : sca3 ( 5`- 766944 .. 765009 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477529 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16051136

Protein [Map View]
MDAQAKKKAMFRSKLNAKKKDTRIDSPLVRYNESDQPVCRVCNVVLKSESLWDVHQASRKHHEAIDNLKASAAGVQRGTK
PAETRPAKTEALAKSSKSQTSSGLPPNFFENHEPARAEVEPAISKNIEQSKQTIGSETNNSKGPLPAGFFDNQKTDSSNT
KTTSEPKQSQTQTTGSETKSVVKGNLPTGFFDNKEADLLARGIKLVKPDIKDEYKEFEKLIQDDLQVVDSRMEEEEVDAA
ETIEEEEQREQRSYKEKVEILKRRKRELKAARLAKRSKTSEGSVKKPKKTEEESLSDEEDDEDSAVDWRAQHL*

DNA
ATGGATGCTCAAGCGAAGAAGAAGGCGATGTTTCGCTCTAAACTCAACGCCAAGAAGAAAGACACCCGCATAGATTCTCC
TCTCGTTAGGTACAACGAATCAGACCAGCCTGTGTGTCGAGTTTGCAATGTCGTCTTGAAATCTGAATCGCTCTGGGATG
TTCATCAAGCTTCTCGTAAGCACCACGAGGCAATTGATAATCTGAAGGCTAGTGCAGCGGGAGTCCAACGGGGTACCAAA
CCTGCTGAAACTCGGCCAGCAAAAACTGAAGCTTTGGCTAAATCATCCAAATCTCAGACATCATCTGGTCTTCCGCCAAA
TTTCTTCGAAAATCATGAGCCTGCTAGAGCAGAAGTAGAACCAGCAATATCCAAGAATATAGAGCAATCCAAGCAGACTA
TAGGTTCAGAAACAAACAATTCAAAGGGACCACTTCCAGCCGGATTCTTTGATAATCAGAAAACTGATTCTTCAAATACC
AAAACCACCAGTGAACCTAAACAGAGTCAGACACAGACCACTGGTTCAGAAACAAAATCTGTGGTGAAAGGAAACCTTCC
GACCGGTTTTTTTGATAATAAAGAAGCTGACCTGCTTGCCCGTGGAATAAAGCTCGTCAAACCAGATATCAAGGATGAAT
ATAAAGAATTTGAGAAGTTGATACAAGATGATCTGCAGGTAGTGGATAGCCGCATGGAAGAAGAAGAGGTTGATGCTGCG
GAAACTATAGAAGAGGAGGAACAACGAGAGCAAAGATCATACAAAGAGAAAGTAGAGATTCTAAAGAGGAGGAAAAGGGA
ACTTAAAGCAGCTAGATTAGCTAAGCGTAGTAAAACCTCTGAGGGGTCTGTTAAAAAGCCGAAGAAGACCGAGGAAGAAT
CCCTCAGCGATGAGGAGGATGACGAGGATTCCGCTGTTGATTGGAGAGCTCAACATCTTTGA