Details for Lyrate rockcress Locus 16051120

Position : sca3 ( 5`- 4363618 .. 4364730 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051120

Protein [Map View]
MDLITETESEIVADSSLWLHNSKSLAEILTEINQNVQRMLRMIEDSEEPESTEKFLCLYQSLGETYNDLNQELLNGLLKL
PCSLVTSMGALSSFKPDMSPDLESGTSYSSLKHQLVSTTSSEKSQSLKLHGEVEKNDSAFLLADMFCAELETARRELEAR
NIDIETEKRHVLDLEGKLSDSSHKIENLESELDEVKECLGVSEAEVSKLMEMLSGCKTEKAKPQTDNADDFLDSLRTELR
SREIQIEQMEEYLNQVLCLKETEIISESGTDKNVVEELRARVEVLEKQVELQRNVITEREEEKREAIRQLCFSLDHYMNR
YLELVRSLSDNKKVSRVK*

DNA
ATGGATTTAATCACAGAAACAGAATCAGAGATTGTTGCTGATTCCTCCTTGTGGCTGCATAATTCTAAATCATTAGCAGA
AATATTAACAGAGATAAATCAGAATGTTCAAAGAATGCTAAGAATGATTGAAGATAGTGAAGAACCTGAGTCAACGGAGA
AATTTCTGTGCTTATATCAGTCTCTCGGTGAAACTTACAATGATTTGAACCAGGAGCTCCTCAACGGCCTTCTCAAACTG
CCATGTTCCCTTGTAACTTCAATGGGGGCATTGAGCTCCTTTAAGCCTGATATGTCTCCTGATTTGGAGTCAGGAACATC
TTACTCATCACTGAAGCACCAACTGGTCTCAACAACGAGTAGCGAAAAGTCGCAGAGCTTGAAACTACATGGTGAGGTTG
AGAAGAACGACTCTGCATTTTTGCTTGCTGATATGTTTTGTGCCGAGCTTGAAACTGCACGGAGGGAATTAGAAGCAAGA
AACATAGACATTGAAACTGAGAAAAGACATGTGCTTGACTTAGAAGGTAAGCTATCAGATTCAAGTCACAAGATTGAGAA
TTTGGAAAGCGAGCTCGACGAGGTTAAAGAGTGTTTAGGTGTGTCAGAAGCCGAAGTTTCAAAGCTAATGGAAATGTTGA
GTGGATGCAAGACAGAGAAAGCGAAACCGCAGACCGATAATGCTGATGACTTTTTAGATAGCCTGAGAACAGAGTTGAGA
TCAAGAGAAATACAAATTGAGCAAATGGAGGAGTATTTGAACCAGGTGTTGTGTCTTAAAGAAACTGAGATTATATCTGA
GTCAGGAACCGACAAGAATGTTGTGGAAGAACTGAGGGCCAGAGTTGAAGTGCTGGAGAAACAAGTGGAGTTGCAGAGGA
ATGTTATAACAGAACGAGAGGAAGAGAAAAGAGAGGCTATAAGACAACTCTGTTTCTCTCTGGATCATTACATGAACAGA
TATTTAGAGCTTGTAAGATCACTTTCTGACAACAAAAAGGTATCCCGTGTTAAGTAA