Details for Lyrate rockcress Locus 16050984

Position : sca3 ( 5`- 3840873 .. 3839725 -3` )
Annotation : [B2G] chaperone -domain containing protein
External links : CoGe
PGDD synteny : 16050984

Protein [Map View]
MVAAILAGAAVAAAAYAGKYGLEAWQAFKLRPVRPRMRKFYEGGFQATMNRREAALILGVRESVAAEKVKEAHRRVMVAN
HPDAGGSHYLASKINEAKDMMLGKTKNSGSAF*

DNA
ATGGTTGCAGCGATACTTGCAGGCGCTGCTGTTGCTGCTGCTGCTTATGCTGGTAAATATGGATTAGAGGCATGGCAAGC
GTTTAAGCTGAGACCAGTTAGGCCTAGAATGCGAAAATTCTATGAAGGTGGTTTCCAAGCTACTATGAATCGGAGAGAAG
CTGCTCTAATTCTCGGTGTTAGGGAGAGTGTAGCGGCAGAGAAGGTGAAGGAAGCTCACCGGAGAGTGATGGTGGCAAAT
CATCCAGATGCAGGAGGAAGCCATTACCTTGCGTCTAAGATCAATGAAGCCAAAGACATGATGCTTGGCAAAACCAAGAA
CTCTGGTTCTGCGTTTTGA