Details for Lyrate rockcress Locus 16050959

Position : sca3 ( 5`- 3141031 .. 3142594 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16050959

Protein [Map View]
MNFVVRRVGSILPSIRHGAVSQIRLARTEAGQPRRRNKLPSLPLKKKEEKSEWWIVDGEMHEIGDHVPPRERFTIPRDNI
PNKRRKQLREQFMRRTRLVLKESEHEPWCKKYMELYNELRENWERLYWDEGYSKKIASDHANYESAEEDDEDFNPYRNRR
SYSDQTKEQGFNRTTQGDNWEKVNQIRDKFEYDRERRMRDKAFAPMNAAPASQESRDLNWNAQRRPFDAERFTRD*

DNA
ATGAACTTTGTCGTCAGACGGGTAGGCTCCATTTTGCCGTCGATACGTCACGGCGCAGTTTCCCAAATCCGGCTAGCCAG
AACAGAGGCAGGTCAGCCGAGACGGCGAAACAAGTTGCCTTCTCTTCCGCTCAAGAAGAAGGAAGAGAAATCCGAGTGGT
GGATAGTCGACGGAGAGATGCACGAGATCGGCGATCACGTCCCTCCTCGTGAGCGGTTCACAATCCCCAGGGACAACATT
CCAAACAAACGCCGGAAGCAGCTCCGTGAGCAGTTCATGCGCCGCACTCGTCTCGTCCTGAAAGAATCGGAACATGAGCC
ATGGTGCAAAAAGTATATGGAACTATATAACGAGCTTAGAGAGAACTGGGAGAGGCTTTATTGGGATGAAGGATATTCAA
AGAAAATCGCAAGTGATCATGCAAATTATGAATCTGCTGAAGAAGACGATGAAGATTTTAATCCATACAGGAACAGGCGG
TCTTACAGCGATCAAACAAAGGAGCAAGGGTTTAATAGAACTACACAAGGTGATAATTGGGAGAAAGTCAATCAAATCAG
GGATAAGTTTGAGTATGATAGAGAAAGGAGGATGAGAGATAAAGCCTTTGCACCAATGAATGCAGCACCAGCCTCTCAAG
AATCTAGGGACTTGAATTGGAATGCACAAAGACGGCCTTTTGACGCTGAGAGATTCACAAGGGATTGA