Details for Lyrate rockcress Locus 16050950

Position : sca3 ( 5`- 1471609 .. 1465282 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16050950

Protein [Map View]
MDFISASSISSPFLTPLSPLSLSSGIVSLKPRYRVKNRNFGSRESNKSRKFVPIRGCFGFSGVNGSFLRSKQSDYGNEAV
PESLRVSGEGNELVPSSVYNAKTRESVIQFVSKPLVYVLFCIAIGFSPIHSFQAPALAVPFVSDVIWKKKKETLKEKEVV
LKAVDHEFSDYTRRLLETVSVLLKTIDKVRKENGDVAEVGTALDTVKVEKEKLQKEIMTGLYRDMRRLRKERDVLMKRAD
GIVDEALRLKKESEKLLRKGAREKVEKLEESVDIMETEYNKIWERIDEIVDIILKKETTTLSFGVRELIFIERECVELVK
SFNRETNQKSSESAPESSITKLSRSEIKQELVNAQRKHLEQMILPNVLELEEVDPFFDRDSVDFSLRIKKRLEESKKLQR
DLQNRIRKRMKKFGEEKLFVQKTPVGEAVKGFPEAEVKWMFGDKEVVVPKAIQLHLRHGWKKWQEEAKADLKQKLLEDVD
FGKQYIAQRQEQVLLDRDRVVSKTWYNEDKNRWEMDPMAVPYAVSRKLIDSARIRHDYAVMYVALKGDDKEYYVDIKEYE
MLFEKFGGFDALYLKMLACGIPTSVHLMWIPMSELSLQQQFLLATRVVSRFFNALRKTQVVSNAKDTVIERIQNINDDIM
MAVVFPVIEFIIPYQLRLRLGMAWPEEIEQTVGSTWYLQWQSEAEMNFKSRNTEDFKWFLWFLIRSSIYGFVLYHVFRFL
KRKVPRLLGYGPFRRDPNVRKFWRVKSYFTYRKRRIKQKRKAGIDPIKTAFDRMKRVKNPPIPLKNFASIESMREEINEV
VAFLQNPKAFQEMGARAPRGVLIVGERGTGKTSLALAIAAEARVPVVNVEAQELEAGLWVGQSAANVRELFQTARDLAPV
IIFVEDFDLFAGVRGKFVHTKQQDHESFINQLLVELDGFEKQDGVVLMATTRNHKQIDEALRRPGRMDRVFHLQSPTELE
RERILHNAAEETMDRELVDLVDWRKVSEKTTLLRPIELKLVPMALESSAFRSKFLDTDELLSYVSWFATFSHVVPSWLRK
TKVAKTMGKMLVNHLGLNLTKEDLENVVDLMEPYGQISNGIELLNPPVDWTRETKFPHAVWAAGRALITLLIPNFDVVEN
LWLEPSSWEGIGCTKITKVTSGGSAIGNTESRSYLEKKLVFCFGSHIASQILLPPGDENFLSSSEITKAQEIATRMVLQY
GWGPDDSPAVYYATSAVSALSMGNIHEYEMAGKVEKIYDLAYEKAKGMLLKNRRVLEKITEELLEFEILTQKPLSRSFLD
VGDPPETALLSAPT*

DNA
ATGGATTTCATTTCCGCTTCTTCCATATCTTCACCCTTTCTCACACCGTTGTCTCCGCTTTCTTTGAGCTCAGGTATAGT
ATCGTTAAAGCCTAGATATCGGGTCAAAAATCGAAACTTTGGGTCTAGAGAATCCAATAAATCTAGGAAATTTGTGCCCA
TTAGAGGCTGCTTTGGTTTTTCCGGCGTAAATGGGAGTTTTTTGAGGTCGAAACAGTCTGATTACGGGAATGAAGCTGTT
CCAGAATCATTGAGAGTAAGTGGAGAGGGAAATGAGCTTGTGCCATCGTCTGTGTATAACGCAAAGACGAGAGAGAGCGT
AATTCAGTTTGTGTCAAAGCCTTTAGTTTACGTCTTATTTTGTATTGCAATTGGGTTTTCACCAATTCACTCTTTTCAAG
CTCCAGCTTTAGCTGTGCCTTTCGTCAGTGATGTGATATGGAAGAAAAAGAAGGAGACATTGAAAGAGAAAGAGGTGGTT
TTGAAAGCAGTTGATCATGAGTTCTCGGATTATACTCGCAGATTGTTGGAGACAGTCTCGGTTTTACTGAAGACTATTGA
CAAGGTTAGAAAGGAAAATGGAGATGTTGCTGAAGTGGGAACGGCTTTGGATACAGTAAAGGTGGAGAAGGAGAAACTGC
AGAAGGAGATAATGACTGGATTGTATCGTGATATGAGGCGCTTGAGGAAGGAGAGAGATGTGTTAATGAAACGAGCTGAT
GGAATTGTAGATGAGGCCCTAAGATTGAAGAAAGAGAGTGAAAAACTGTTGAGAAAAGGTGCTAGGGAGAAAGTGGAGAA
ATTGGAAGAGAGTGTGGATATAATGGAGACCGAGTACAACAAGATATGGGAAAGAATAGATGAGATTGTTGATATCATTT
TAAAGAAAGAGACAACAACATTGAGTTTTGGGGTTAGGGAGCTTATTTTCATCGAAAGAGAGTGTGTAGAGTTGGTTAAA
AGCTTCAACCGAGAAACGAATCAAAAAAGTTCTGAAAGTGCTCCTGAAAGTTCCATTACAAAACTTTCGAGGTCTGAGAT
TAAGCAGGAATTAGTGAACGCTCAAAGAAAGCACTTGGAACAAATGATACTGCCTAATGTTTTGGAACTCGAGGAGGTTG
ATCCCTTTTTCGATCGTGACTCAGTGGATTTTTCTCTACGCATCAAAAAACGCCTTGAGGAATCAAAAAAGCTGCAGAGG
GATCTTCAGAATCGTATCAGAAAACGTATGAAAAAGTTTGGTGAAGAAAAGCTTTTTGTTCAAAAGACTCCAGTAGGTGA
AGCTGTCAAAGGATTTCCTGAAGCTGAGGTGAAATGGATGTTTGGAGACAAGGAGGTGGTTGTTCCGAAAGCTATCCAGC
TCCATCTACGCCATGGTTGGAAAAAGTGGCAGGAAGAAGCAAAAGCTGATTTGAAACAGAAACTTTTGGAAGATGTTGAT
TTTGGTAAACAATATATTGCGCAGAGACAGGAACAAGTACTCCTGGATCGAGATAGAGTTGTTTCAAAGACTTGGTATAA
CGAAGACAAAAATAGGTGGGAGATGGACCCTATGGCTGTTCCATATGCAGTTTCCAGGAAGCTGATTGACAGTGCCAGGA
TTAGGCATGATTATGCTGTAATGTATGTTGCATTAAAAGGAGATGACAAGGAGTATTACGTTGACATCAAGGAATATGAG
ATGCTATTTGAGAAGTTTGGAGGGTTTGATGCTCTATACCTGAAAATGCTTGCTTGTGGAATCCCAACTTCTGTTCATCT
GATGTGGATACCCATGTCAGAGCTAAGTCTTCAACAACAGTTTCTGTTGGCTACAAGGGTGGTTTCTCGATTCTTTAACG
CATTGAGGAAGACTCAAGTTGTATCAAATGCGAAGGATACTGTAATAGAGAGAATACAGAATATAAACGATGACATTATG
ATGGCGGTCGTGTTTCCAGTTATCGAATTTATCATTCCTTACCAGTTAAGGCTGCGTCTGGGAATGGCTTGGCCGGAAGA
AATAGAACAGACTGTTGGCTCAACATGGTACTTACAATGGCAGTCTGAAGCAGAGATGAATTTCAAGTCCCGCAATACAG
AAGATTTTAAGTGGTTCCTCTGGTTTCTAATTCGAAGTTCTATATACGGGTTTGTTTTGTATCATGTTTTCCGCTTTCTG
AAAAGAAAGGTTCCAAGACTTCTTGGCTATGGACCCTTCCGCCGAGATCCAAATGTACGGAAATTCTGGAGAGTGAAATC
ATATTTTACTTATAGAAAAAGGAGAATCAAACAAAAGAGAAAGGCTGGAATAGACCCCATAAAAACTGCATTCGACAGAA
TGAAGAGAGTGAAAAATCCACCAATCCCATTAAAAAACTTTGCTAGTATTGAGTCTATGAGAGAAGAAATCAATGAGGTT
GTAGCATTTTTACAGAATCCAAAGGCATTTCAGGAGATGGGTGCCAGAGCACCTCGGGGAGTACTTATTGTGGGTGAGAG
AGGAACGGGAAAGACGTCACTGGCGCTCGCTATAGCAGCCGAAGCAAGAGTGCCTGTTGTCAATGTTGAAGCTCAAGAGT
TGGAAGCTGGACTATGGGTTGGTCAAAGTGCAGCGAATGTCAGGGAACTCTTTCAAACTGCAAGAGACTTGGCACCTGTT
ATCATTTTTGTGGAGGATTTTGACCTCTTTGCCGGTGTACGCGGGAAGTTCGTACATACAAAACAGCAAGATCATGAATC
GTTCATTAATCAGCTTCTTGTTGAACTTGATGGCTTTGAGAAACAGGATGGCGTAGTTTTGATGGCTACGACACGAAATC
ATAAGCAAATTGATGAGGCGTTAAGAAGGCCAGGTCGTATGGATAGAGTATTCCATCTTCAAAGTCCAACTGAATTGGAA
AGGGAAAGGATTTTACACAACGCTGCAGAAGAAACCATGGACAGAGAACTCGTTGATTTAGTGGATTGGCGTAAGGTTTC
GGAGAAGACAACTTTATTACGACCGATAGAACTGAAACTTGTTCCAATGGCTCTCGAAAGTAGTGCCTTCAGAAGCAAAT
TTCTGGACACTGACGAACTTCTGAGTTATGTTAGCTGGTTTGCGACGTTTAGCCATGTAGTGCCCTCGTGGCTGCGGAAA
ACTAAAGTTGCAAAGACAATGGGCAAAATGCTTGTGAATCATCTTGGACTCAACTTAACCAAAGAAGATTTGGAGAATGT
GGTTGATCTGATGGAACCATATGGACAAATAAGCAATGGAATAGAACTTTTGAATCCTCCTGTTGATTGGACGAGGGAGA
CAAAGTTCCCACATGCTGTCTGGGCGGCTGGTCGTGCTCTCATCACACTTCTAATACCAAACTTCGATGTTGTGGAAAAT
CTTTGGCTTGAGCCTAGTTCCTGGGAGGGAATTGGGTGTACAAAAATTACCAAGGTCACAAGTGGAGGCTCTGCGATTGG
GAATACAGAATCAAGATCGTATCTTGAAAAGAAGCTCGTTTTCTGCTTTGGATCTCACATTGCATCCCAAATACTTCTTC
CTCCCGGAGATGAAAATTTTCTTTCTTCTTCAGAAATAACTAAAGCGCAGGAGATTGCAACACGTATGGTGCTTCAATAT
GGCTGGGGACCCGATGACAGTCCTGCAGTATACTATGCTACTAGCGCGGTTTCAGCTTTGAGTATGGGGAACATTCACGA
ATATGAAATGGCGGGAAAAGTTGAAAAGATTTACGACTTAGCGTACGAAAAGGCAAAGGGAATGCTACTTAAAAATCGCC
GTGTCCTTGAGAAAATCACAGAGGAGCTACTCGAATTTGAGATCTTAACTCAGAAGCCATTGTCAAGGAGTTTTCTTGAT
GTTGGAGATCCGCCAGAAACTGCACTTCTTAGTGCACCAACCTAA