Details for Lyrate rockcress Locus 16050931

Position : sca1 ( 5`- 7756149 .. 7753072 -3` )
Annotation : [B2G] zinc finger family protein
External links : CoGe
PGDD synteny : 16050931

Protein [Map View]
MVFFPLWAFHAVVARGRFSLPAPVAPRNRHWAPCHAVVATPLLVAFELLLCIYLESSYARWPPAVSLKIAFVPLFAFELT
ILVDNLRMCRALMPGDDDSITDDAIWEALPHFWVAISMVFTLAATFFTLLKLSGDVVALGWWDLFINFGIAECFAFLVCT
KWSNPVIHRSSRARETGSSSTTIRYLDWNSGLVVAPEEDRHQDRWCGLQDIGGHMLKIPVIVFQVVLCMYLEGTPERAKD
ISIPLLFSPLFLLQGLGVLFAASKLIEKIVLLLRGEAGPGLYFRFSSSAHDCLGFLHHGSRLLGWWSIDEGSREEQARLY
FDQESGYNTFSGHPPEVVKKMPKEDLAEEVWRLQAALGEQTEITKFSQQEYERLQNEKVLCRVCFEKEISLVLLPCRHRV
LCRVCADKCTTCPICRIDIEKRLSVYDV*

DNA
ATGGTGTTTTTCCCGCTGTGGGCTTTTCATGCAGTTGTTGCAAGGGGAAGATTCTCTCTTCCTGCTCCTGTTGCTCCACG
TAACCGTCATTGGGCTCCTTGCCATGCTGTTGTCGCTACACCGTTGCTTGTAGCATTCGAATTACTCCTCTGTATATACC
TCGAGAGTTCTTATGCTCGTTGGCCACCAGCTGTGAGTCTGAAGATTGCATTTGTACCGTTATTTGCATTTGAATTAACG
ATACTGGTGGACAATTTGAGAATGTGTCGAGCATTGATGCCAGGCGACGACGACAGCATAACTGATGATGCAATATGGGA
GGCACTTCCTCATTTCTGGGTTGCAATTTCCATGGTGTTCACGTTGGCTGCTACGTTTTTTACCCTCCTAAAGCTTTCTG
GCGATGTAGTTGCTCTTGGATGGTGGGATTTATTCATAAATTTTGGAATTGCCGAGTGCTTTGCTTTTCTTGTTTGCACA
AAATGGTCCAACCCAGTAATCCATAGAAGCTCACGTGCCCGAGAAACCGGGTCATCTTCTACCACTATCAGATATCTTGA
CTGGAACAGTGGCCTTGTGGTTGCTCCAGAAGAGGATAGGCACCAAGATAGATGGTGCGGTTTGCAAGATATTGGTGGTC
ATATGTTAAAAATTCCCGTTATTGTATTTCAAGTTGTTCTTTGCATGTATCTAGAGGGGACTCCTGAAAGAGCTAAGGAT
ATATCCATTCCATTACTCTTCTCTCCACTATTTCTATTGCAAGGCCTCGGTGTTCTCTTTGCTGCTTCTAAACTCATAGA
GAAGATCGTTCTCTTACTGCGCGGGGAAGCTGGTCCAGGATTGTATTTTAGATTTTCATCAAGTGCCCATGATTGCTTGG
GATTTTTGCACCATGGTTCCAGGCTATTAGGTTGGTGGTCGATTGACGAAGGAAGCCGGGAGGAACAAGCTCGACTGTAC
TTTGATCAAGAATCTGGTTACAATACATTCAGTGGTCATCCGCCTGAGGTAGTCAAGAAAATGCCAAAGGAAGATCTTGC
TGAAGAGGTATGGAGACTTCAAGCAGCACTTGGTGAACAAACAGAAATCACAAAATTCAGCCAGCAAGAATATGAAAGAC
TGCAAAATGAGAAAGTGCTGTGTAGGGTTTGCTTTGAAAAAGAAATCAGTTTGGTACTGCTTCCATGTAGACACCGTGTT
CTCTGCAGAGTCTGTGCAGACAAGTGTACAACGTGCCCAATATGTCGTATAGACATTGAAAAACGACTATCTGTATACGA
CGTTTGA