Details for Lyrate rockcress Locus 16050927

Position : sca3 ( 5`- 7899639 .. 7900200 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16050927

Protein [Map View]
MGRKKGLPEFEESAPDGFDPANPYKDPVAMVEMREHIVREKWIQIEKAKILREKVKWCYRVEGVNHYQKCRHLVQQYLDS
TRGVGWGKDHRPISLHGPKPEAVEAE*

DNA
ATGGGGAGAAAGAAGGGATTACCGGAGTTCGAAGAATCGGCGCCGGATGGATTTGATCCGGCCAATCCTTACAAGGATCC
GGTGGCGATGGTTGAAATGAGAGAACACATCGTTCGAGAGAAATGGATCCAAATCGAGAAAGCTAAGATCTTGCGTGAGA
AGGTCAAATGGTGTTACCGCGTCGAAGGAGTCAATCACTACCAGAAATGTCGTCATCTTGTTCAGCAGTATCTTGATTCC
ACTCGCGGCGTCGGTTGGGGAAAGGATCATCGTCCTATTTCGCTCCACGGTCCCAAACCGGAGGCTGTTGAAGCTGAATA
A