Details for Lyrate rockcress Locus 16050867

Position : sca3 ( 5`- 5304835 .. 5302168 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16050867

Protein [Map View]
MEGKFPISETTNLLQRIKDFTRSIVEDLAEGRSPKISINRFRNYCINPEADCLCSSDTPKGQEILTLERKPQTYRIDMLL
RVLLIVQQLLQENRHASKRDIYYMHPSAFKAQSIVDRAIGDICILFQCSRYNLNVVSVGNGLVMGWLKFREAGRKFDCLN
SLNTAYPVPVLVEEVEDIVSLAEYILVVEKETVFQRLANDMFCKTNRCIVITGRGYPDVSTRRFLRLLMEKLHLPVHCLV
DCDPYGFEILATYRFGSMQMAYDIESLRAPDMKWLGAFPSDSEIYSVPKQCLLPLTEEDKKRTEALLLRCYLKREMPRWR
LELETMLKRGVKFEIEALSVHSLSFLSEVYIPSKIRREVSSP*

DNA
ATGGAGGGAAAATTTCCGATTTCAGAAACGACTAATTTGCTTCAAAGGATCAAAGATTTTACTCGATCGATCGTTGAAGA
TCTGGCTGAAGGAAGATCTCCAAAAATTTCCATCAATCGATTCAGGAACTATTGCATCAATCCAGAAGCGGATTGCTTAT
GCAGCTCTGATACACCAAAGGGTCAGGAAATTCTCACTCTTGAGAGGAAACCCCAAACCTACAGAATCGATATGTTGCTA
AGAGTATTGTTGATTGTCCAACAACTTCTTCAAGAAAATAGACATGCATCCAAAAGAGATATCTACTACATGCATCCTTC
AGCATTCAAAGCACAATCCATTGTGGACCGCGCCATTGGTGATATATGCATTCTTTTTCAGTGTAGTCGGTACAACTTGA
ATGTGGTTTCTGTTGGAAACGGGTTGGTGATGGGATGGTTAAAATTTAGGGAAGCTGGAAGAAAGTTTGATTGTTTAAAC
AGCTTGAACACTGCATATCCCGTTCCTGTTCTTGTAGAGGAAGTCGAAGATATTGTTAGCTTAGCAGAGTACATACTGGT
TGTAGAAAAAGAAACAGTATTCCAGCGTTTAGCAAATGACATGTTTTGCAAGACGAACCGCTGCATTGTTATCACAGGAA
GAGGATATCCAGATGTCTCAACAAGAAGGTTCTTGCGACTCCTCATGGAGAAGTTGCATCTACCTGTGCATTGTCTAGTC
GACTGTGATCCATATGGCTTTGAGATCCTAGCCACATACCGTTTTGGCTCCATGCAAATGGCCTATGATATTGAATCATT
ACGAGCACCAGATATGAAATGGTTGGGAGCTTTTCCTTCAGACTCTGAGATATACAGTGTTCCCAAACAGTGTCTTTTGC
CTTTGACAGAAGAAGATAAGAAAAGAACTGAAGCATTGTTGCTTAGATGCTACCTGAAGCGTGAAATGCCGCGATGGAGG
TTGGAACTTGAAACGATGCTGAAAAGAGGAGTGAAGTTTGAGATCGAAGCACTCTCAGTTCACTCACTGTCCTTTTTGTC
AGAGGTTTATATTCCTTCTAAGATTCGTCGTGAGGTAAGCTCACCTTGA