Details for Lyrate rockcress Locus 16050849

Position : sca3 ( 5`- 6661856 .. 6661347 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16050849

Protein [Map View]
MDLNNNNSNIFKTLARWCLLLQAFMISSKTVALKEPDYVNMNITIRNAMTGLLRPEIVYRCQSKHKDYGWHRSTKPGIQF
SFPIILIKGENKIPAIHICEFRSVLGTATLVIQNTHLDAEMCPRSSCAHEATPKGIVFRGLEWDFRTVFPKLKPVEYLEL
PWTPWPNRT*

DNA
ATGGATCTTAACAACAACAACAGCAACATTTTCAAAACCCTAGCTCGGTGGTGTCTTCTTCTACAAGCCTTCATGATCTC
GTCCAAGACCGTGGCTCTGAAGGAACCTGACTACGTAAACATGAACATAACAATCCGTAACGCAATGACAGGATTACTCC
GACCGGAAATTGTTTACCGATGCCAGTCTAAACACAAAGACTATGGTTGGCATCGATCTACAAAGCCAGGAATCCAATTT
TCATTCCCAATCATCCTCATAAAAGGCGAAAACAAAATACCGGCGATTCACATCTGCGAATTCCGGTCCGTCTTAGGAAC
GGCTACACTCGTGATCCAAAACACCCATCTGGACGCCGAGATGTGCCCTAGATCGTCGTGTGCTCACGAGGCAACCCCGA
AAGGAATTGTGTTTAGAGGCCTTGAATGGGATTTCAGAACCGTATTTCCTAAACTCAAACCAGTTGAGTATCTAGAATTG
CCGTGGACACCTTGGCCAAACAGAACATGA