Details for Lyrate rockcress Locus 16050821

Position : sca3 ( 5`- 8836048 .. 8837558 -3` )
Annotation : [B2G] mitochondrial substrate carrier family protein
External links : CoGe
PGDD synteny : 16050821

Protein [Map View]
MAMVVPKEGLVVMEKESLSSASSDSHLRLQPHFPDFTIPVKDFFKSREAREFLSGALAGAMTKAVLAPLETIRTRMIVGV
GSRSIPGSFLEVVQKQGWQGLWAGNEINMIRIIPTQAIELGTFEWVKRAMTSAQVKLKKIEDAKIEIGDFSFSPSISWIS
PVAVAGASAGIASTLVCHPLEVLKDRLTVSPEIYPSLTLAIPRIFRDDGIRGFYAGLGPTLVGMLPYSTCYYFMYDKMKT
SYCKSKNKKALSRPEMLVLGALAGLTASTISFPLEVARKRLMVGALKGQCPPNMAAAIAEVVKKEGVMGLYRGWGASCLK
VMPSSGITWVFYEAWKDILLAANTKPLI*

DNA
ATGGCAATGGTTGTTCCAAAAGAAGGGCTTGTGGTTATGGAGAAGGAATCTCTTTCTTCAGCTTCATCGGATTCTCATCT
TCGTCTCCAACCTCACTTTCCTGACTTCACGATTCCTGTTAAAGATTTCTTCAAGTCTAGGGAAGCCCGTGAGTTTCTTA
GTGGGGCTTTAGCTGGAGCTATGACCAAAGCTGTTCTTGCTCCACTTGAGACTATAAGGACAAGAATGATTGTTGGTGTT
GGATCGAGAAGCATTCCAGGTAGTTTTCTGGAAGTTGTACAGAAGCAAGGGTGGCAAGGTCTTTGGGCTGGCAACGAAAT
CAATATGATTCGAATCATTCCAACTCAAGCAATTGAGTTGGGGACATTTGAATGGGTAAAACGCGCAATGACATCAGCTC
AAGTGAAGTTGAAGAAGATTGAAGACGCCAAGATTGAAATCGGTGATTTTAGTTTCAGTCCGTCCATATCGTGGATCTCT
CCTGTTGCGGTGGCTGGTGCATCTGCTGGTATTGCTAGTACGCTTGTTTGCCATCCTCTCGAAGTTCTCAAGGATAGATT
GACTGTGAGCCCTGAGATTTATCCAAGCTTAACCCTTGCAATTCCAAGGATTTTCAGAGACGATGGAATCCGTGGATTTT
ACGCTGGCTTAGGACCAACACTGGTCGGGATGCTTCCATACAGCACATGTTATTACTTCATGTATGACAAAATGAAGACG
TCATACTGCAAATCCAAGAACAAAAAGGCTTTAAGCCGTCCAGAGATGCTTGTTCTTGGAGCTTTAGCGGGTCTAACGGC
GAGCACCATAAGCTTTCCGTTGGAAGTCGCGCGGAAGCGGTTGATGGTTGGAGCTCTGAAGGGGCAATGCCCACCGAACA
TGGCTGCAGCAATTGCAGAAGTAGTGAAGAAAGAAGGAGTGATGGGACTCTACAGAGGATGGGGAGCAAGTTGTTTGAAA
GTCATGCCGTCTTCAGGCATCACTTGGGTCTTCTATGAAGCCTGGAAAGACATTTTGCTTGCAGCCAACACCAAACCACT
CATATAA