Details for Lyrate rockcress Locus 16050814

Position : sca3 ( 5`- 5148914 .. 5148288 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16050814

Protein [Map View]
MASDQSTNPPIMEAKTRHPLHQIADTPTHKLLLKQWLKEEELILSRVSHKESQIDSVRREITQLYIFFFLFHSISLLLLF
HASSSSSPSSASASSACKRSWIPSLCALLSSLGIIWAVRYKSEVESHLEKLLEREKEDAKLLRKCVEELKKKGIEFDLLK
EVDALRRAKSLRVESKPVRKWSARDFVTLFFFSVSCLVLAMIRLILCD*

DNA
ATGGCGTCAGATCAGAGCACAAATCCACCGATCATGGAGGCAAAGACGAGACATCCTCTTCACCAGATCGCAGATACACC
AACACACAAGCTTCTCCTGAAACAATGGCTAAAAGAAGAAGAGCTAATCCTCAGCCGTGTCTCTCACAAAGAATCTCAGA
TCGATTCCGTTCGAAGAGAAATCACTCAGCTTTACATTTTCTTCTTTCTCTTCCACTCCATTTCTCTGTTACTCCTCTTC
CACGCCTCTTCTTCATCATCACCTTCCTCTGCTTCTGCTTCCAGTGCTTGTAAAAGATCATGGATCCCTTCACTCTGCGC
TCTGCTATCTTCGTTGGGAATCATTTGGGCGGTGAGGTACAAATCGGAAGTGGAATCGCATCTTGAGAAGTTGTTGGAGA
GGGAGAAAGAAGATGCGAAGCTGTTGCGTAAATGTGTTGAAGAGTTGAAGAAGAAAGGTATCGAATTTGATTTGCTTAAG
GAAGTTGATGCTCTTCGTAGAGCAAAGAGTTTGAGAGTTGAGTCCAAGCCTGTGAGGAAATGGTCTGCTAGGGATTTTGT
GACGCTCTTCTTCTTCTCTGTTTCGTGTTTGGTTCTTGCCATGATTAGGCTTATTCTCTGCGATTAG