Details for Lyrate rockcress Locus 16050792

Position : sca3 ( 5`- 2442760 .. 2441224 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16050792

Protein [Map View]
MSKEEFMKIQTCVLKVNIHCDGCKQKVKKILQKIEGVFTTKIDSEQGKVTVSGSVDPSVLIKKLAKSGKHAEIWGAPKGN
NNPNQSQMANQFKGMQIDNGKGAGGGGGGNNNNNKKGQKSGGGGGGGNSNAPKMGQQLNPQHMQQLQKMKGFQDLKLPPQ
LKGSVPVNKNQNQKGVKFDVPEDDDDDDFSDEFDDEFTDDDDDEFDDEFDDLPLPSNKMKPNMTMMPNAQQMMMNAQKNA
NLGGGPAKNGGKGAPAGGGGGGKGGPGGGGNQNQGGGKNTGGGHPPDGKNGGGPNAGKKGNGGGGPMAGGLPGGFRPMGG
GGPPNMSMPMGMGGQMGNMPAVQGLPATGPGGAPPGYFQGAGPDPMQMQQQQYLAAVMNQQRAMGNERFQPMMYARPPPA
VNYMPPHPHQYPNPHPYPYPYPPPYGNDQYSHAFSDENTSSCDIM*

DNA
ATGAGTAAAGAAGAGTTCATGAAGATCCAGACTTGTGTTCTTAAAGTGAACATACACTGTGATGGCTGTAAGCAGAAAGT
CAAGAAAATCTTGCAGAAAATCGAAGGTGTTTTCACGACCAAGATTGACTCAGAACAAGGGAAAGTGACTGTCTCTGGGA
GCGTAGATCCTTCAGTTCTCATCAAGAAGCTCGCCAAATCTGGTAAACATGCTGAAATCTGGGGAGCTCCAAAGGGTAAC
AACAATCCAAATCAGTCCCAAATGGCCAATCAGTTTAAAGGAATGCAGATTGACAATGGAAAAGGCGCTGGCGGTGGCGG
CGGCGGAAACAATAACAACAACAAGAAAGGCCAGAAAAGCGGAGGAGGCGGCGGTGGAGGTAACAGTAATGCGCCAAAGA
TGGGTCAGCAACTGAATCCCCAACATATGCAGCAGCTTCAGAAGATGAAAGGGTTTCAAGATCTGAAGCTTCCTCCTCAG
TTAAAAGGCTCTGTTCCTGTCAACAAGAACCAAAACCAGAAAGGAGTGAAGTTTGATGTTCCTGAGGATGATGATGATGA
TGATTTTAGTGACGAATTCGATGATGAGTTTACTGATGATGATGACGACGAGTTTGATGATGAGTTTGATGATCTCCCTC
TTCCGTCTAATAAGATGAAGCCCAACATGACGATGATGCCTAATGCTCAACAGATGATGATGAACGCTCAAAAGAACGCC
AATCTTGGCGGTGGCCCTGCTAAAAACGGCGGTAAAGGCGCTCCCGCTGGTGGTGGCGGCGGTGGCAAAGGTGGTCCTGG
TGGTGGTGGGAATCAAAACCAAGGTGGAGGCAAGAACACTGGTGGTGGACATCCACCAGATGGTAAAAACGGCGGTGGTC
CAAACGCCGGAAAGAAGGGTAACGGCGGAGGTGGGCCCATGGCTGGAGGACTTCCGGGTGGTTTCCGACCCATGGGAGGC
GGAGGACCACCGAACATGAGCATGCCTATGGGTATGGGTGGTCAAATGGGGAATATGCCGGCGGTACAGGGGTTACCAGC
GACCGGTCCAGGCGGTGCACCACCGGGTTATTTCCAAGGGGCCGGGCCAGATCCGATGCAAATGCAGCAACAGCAATATT
TAGCAGCGGTTATGAACCAGCAACGAGCTATGGGGAACGAGCGGTTCCAACCAATGATGTACGCACGGCCACCACCGGCA
GTTAACTATATGCCGCCACATCCGCACCAATATCCGAATCCTCATCCGTACCCGTATCCATATCCTCCACCTTACGGGAA
TGATCAATACTCTCATGCCTTTAGCGACGAGAACACATCAAGCTGTGATATTATGTGA