Details for Lyrate rockcress Locus 16050784

Position : sca3 ( 5`- 3127510 .. 3132343 -3` )
Annotation : [B2G] lipase class 3 family protein
External links : CoGe
PGDD synteny : 16050784

Protein [Map View]
MESIQSRVESWIRDQRARFLRVSWGPIQWRFRWPPWNGGDADQRIKIRREYEKRKKQIEDLCLALKSESVEDLQDILCCM
VLSECVYKRPASEMVRAVNKFKADFGGQFISLERVQPSSDHVPHRYLLAEAGDTLFASFVGTRQYKDIMADANILQGHIF
HDDVAEDECIAASEPIQSEPLKKNGEGLRNPKQLRQKPKPAAHRGFLARAKGIPALELYRLAQKKKRKLVLCGHSLGGAV
AALATLAILRVVAASSKKENENIHVKCITFSQPPVGNAALRDYVHEKGWHHYFKSYCIPEDLVPRILSPAYFHHYNEQRM
SMAGETEATNGQGVSSEAEKRKNKEHEQLVIGVGPVQNSFWRLSKLVPLEAVKKQLDRYIGKKEDPGETSTANESAVSAP
IGDVVIEPQSLEIEEGKDGISLKPLPDTGNAQTVSGRSEGKNNSPNGFRVPYLPSYVPFGELYLLGTASVESLSEGEYSK
LTSVRSVITELRERLQSHSMKSYRSRFQRIHDLCMDVDGFFGVDQQKQFPHLQQWLGLAVGGSIELGHIVESPVIRTATS
IAPLGWKGVPGDKNAEPLKVDITGFGLHLCSFVHAQVNGNWCSTTVESFPTTPAYSSDNVEQTELQKIRVVIGAPLKRPP
SNQIVEDPLVPMFSSVDSNTGFPKEGINLGFFQEDKFVRPEGLEDLYIFCTSDFATVAKEVEVRTRRVRLLGLEGAGKTS
LFRAILGQSMLSSMTHVENLQIQSDVQECIIGGVCYSDTVGVNLQELHLEASRFREELWKGVRNLSKKIDLIILVHNLSH
RIPRYQNSTTQLQQQQPALALLLDEVKSLGIPWVLAITNKFSVSAHQQKSAIEAVLQAYQASPNTTGIVNSIPYIISGSG
TSSLPWAAVNAGNDGSVGAQKMIFAPLDLVKKPFQRKDTVFPVDGVNSLCQLVHRVLQTQEEACFQELARDRLLVELAKD
RAVDGSQGKSSSLSAAAVGASLGAGLGLVLAVVMGAGSALRKP*

DNA
ATGGAGTCGATACAGAGCCGAGTGGAATCGTGGATCAGAGATCAGAGGGCAAGGTTCTTACGGGTTTCGTGGGGACCGAT
TCAATGGAGATTCCGGTGGCCTCCATGGAACGGAGGAGATGCCGATCAGAGGATTAAGATCCGTCGGGAATATGAGAAGC
GCAAAAAGCAAATTGAGGATCTCTGTCTGGCCCTTAAATCCGAGTCTGTCGAAGATTTACAAGACATACTATGCTGCATG
GTACTCTCCGAGTGTGTTTACAAGAGACCTGCAAGTGAGATGGTTCGAGCTGTTAACAAATTTAAAGCAGACTTCGGTGG
CCAATTTATTTCGCTGGAGAGAGTTCAACCTTCATCAGATCACGTTCCTCACAGGTATCTACTTGCTGAGGCAGGTGATA
CATTATTTGCATCCTTTGTTGGAACTAGGCAATATAAGGACATCATGGCCGATGCAAATATACTTCAAGGTCACATTTTT
CACGATGATGTCGCAGAGGATGAATGTATCGCAGCATCTGAACCTATTCAAAGTGAACCACTTAAGAAAAATGGAGAGGG
TTTGCGGAATCCTAAGCAACTTAGACAGAAGCCTAAACCTGCTGCTCATCGGGGATTCTTGGCTCGTGCTAAGGGGATAC
CTGCTCTGGAACTGTATAGGCTTGCTCAGAAAAAGAAACGAAAACTTGTATTATGTGGACACTCACTTGGTGGAGCTGTA
GCTGCCTTAGCTACACTTGCTATATTGAGGGTTGTTGCTGCCTCTTCAAAGAAAGAAAATGAAAATATTCATGTCAAATG
TATAACCTTTTCCCAGCCCCCTGTTGGAAATGCTGCTTTGAGAGATTATGTTCATGAAAAAGGGTGGCATCATTATTTCA
AAAGCTACTGTATACCTGAAGATTTGGTCCCGAGGATATTATCTCCTGCATATTTTCATCATTACAATGAACAAAGAATG
TCAATGGCTGGAGAGACTGAAGCCACAAATGGCCAGGGCGTATCATCAGAGGCAGAAAAGAGAAAAAATAAGGAGCACGA
GCAGTTAGTCATTGGTGTTGGCCCTGTTCAGAACTCATTCTGGAGGCTTTCAAAACTTGTCCCCCTAGAGGCTGTTAAGA
AACAACTGGATAGGTACATAGGAAAGAAAGAGGATCCTGGAGAGACGTCTACTGCAAATGAATCCGCAGTGTCAGCTCCT
ATTGGGGATGTGGTTATTGAACCACAATCTCTTGAAATAGAAGAGGGTAAGGATGGTATATCTCTCAAGCCATTGCCAGA
TACTGGTAATGCACAAACAGTTAGTGGAAGAAGTGAAGGAAAGAACAATTCGCCTAATGGGTTCAGGGTTCCATATCTAC
CCTCTTACGTTCCATTTGGAGAGCTATATCTCTTGGGAACTGCATCTGTGGAATCACTTTCAGAAGGAGAGTACTCTAAA
TTGACATCGGTCAGATCTGTGATAACCGAACTGAGAGAACGCCTTCAGTCGCATTCTATGAAGTCCTATAGGTCTCGTTT
CCAGAGAATACATGACCTCTGCATGGACGTTGATGGTTTTTTTGGAGTGGATCAACAGAAGCAGTTTCCACATCTACAAC
AGTGGCTTGGACTTGCTGTTGGTGGTAGTATAGAACTTGGGCACATTGTTGAATCACCGGTTATTAGAACCGCCACTTCT
ATCGCCCCTCTTGGCTGGAAAGGCGTTCCGGGTGATAAGAATGCAGAACCTCTAAAAGTTGATATCACTGGATTTGGCTT
GCATTTGTGTTCTTTTGTACATGCACAAGTGAATGGCAACTGGTGCTCAACTACCGTGGAATCCTTTCCTACAACACCTG
CTTATTCTTCAGATAATGTAGAACAGACAGAACTACAGAAGATTAGGGTGGTCATTGGAGCTCCTCTGAAACGACCTCCA
AGCAATCAGATAGTTGAAGATCCTTTAGTTCCTATGTTCTCGTCTGTTGATTCGAACACCGGTTTTCCAAAGGAAGGAAT
CAACCTAGGATTTTTTCAAGAGGACAAGTTTGTTCGTCCTGAAGGTTTGGAAGACTTGTATATATTCTGCACTAGTGATT
TCGCTACTGTAGCTAAGGAAGTTGAGGTCAGAACACGGAGGGTGAGATTACTCGGGCTTGAGGGTGCTGGTAAAACCTCT
CTATTCCGCGCAATACTGGGTCAAAGCATGCTGAGTTCGATGACTCATGTGGAGAATCTTCAGATACAATCCGATGTTCA
AGAATGTATTATTGGTGGTGTTTGCTACTCGGACACGGTGGGCGTAAACCTGCAGGAGCTTCACTTAGAAGCATCTCGCT
TCAGAGAAGAACTATGGAAAGGAGTTCGTAATCTAAGTAAAAAGATTGATTTGATTATTCTTGTGCACAATCTCTCTCAC
AGAATACCACGTTACCAAAACTCTACAACGCAACTGCAGCAACAGCAACCAGCACTTGCTCTTCTGTTAGACGAGGTTAA
ATCTCTCGGTATCCCTTGGGTCCTCGCCATAACAAACAAGTTCTCAGTCAGTGCCCATCAGCAGAAATCCGCTATAGAAG
CTGTACTTCAGGCATACCAAGCGTCTCCAAACACAACCGGAATTGTCAACTCTATCCCTTATATTATTTCTGGCTCTGGA
ACTTCCTCATTGCCTTGGGCAGCTGTGAATGCAGGTAATGATGGATCAGTAGGCGCGCAGAAGATGATATTCGCTCCACT
CGACCTTGTCAAAAAGCCTTTTCAGAGAAAAGACACTGTTTTTCCAGTGGATGGTGTGAATTCCCTTTGCCAGCTTGTCC
ATCGTGTCCTTCAAACTCAAGAAGAAGCTTGCTTTCAGGAACTTGCTAGAGACAGACTGCTGGTGGAACTAGCCAAAGAC
CGTGCTGTAGATGGTTCACAGGGCAAGTCATCGTCTTTGTCAGCAGCAGCTGTGGGCGCTTCACTTGGAGCTGGTCTTGG
CCTTGTCTTGGCAGTAGTAATGGGTGCTGGTTCCGCTTTACGAAAACCGTGA