Details for Lyrate rockcress Locus 16050756

Position : sca3 ( 5`- 748515 .. 750102 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896259 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16050756

Protein [Map View]
MESAPTGCFKCGRPGHWSRDCPSSAPVAGNNSVSSSSGPSQIPNNEFQRSSNKSGNPAAGTSIAPVPKVTKTRVQRPKLT
PELLLSEDGLGYVLRYFPKSFKYRGRGKEVSDLGNLIRLYSEWHSHLLPYYSFDHFVHKVQQVASTKRVKNCINELRERV
ASGVDPNKLYEKPEENTGPYDDQDMDQPGQEEENIPSKSADADTNADAFEDSMLNEIFDSASQLPSDEQILDKSSELTEE
QRARMEANRLKAMEKAQNISEEQRVRMEANRLKALERAKARLQPNQD*

DNA
ATGGAATCAGCTCCGACGGGATGCTTCAAATGTGGCCGTCCCGGTCACTGGTCTCGCGATTGTCCATCGTCGGCTCCGGT
CGCCGGCAATAATTCCGTTTCGTCTTCTTCCGGTCCATCTCAAATCCCTAATAATGAATTTCAGAGATCCTCCAATAAAA
GTGGAAATCCTGCCGCCGGAACCTCCATAGCTCCTGTTCCTAAAGTGACGAAGACGAGAGTGCAAAGGCCCAAGCTAACT
CCTGAATTGTTACTCTCTGAGGATGGTCTCGGCTATGTTCTTCGTTATTTCCCTAAATCCTTCAAGTATCGTGGCCGAGG
CAAGGAGGTTAGCGATTTGGGGAATTTGATACGGCTGTACAGTGAGTGGCACTCTCATTTGCTACCTTACTATTCCTTTG
ATCACTTTGTGCATAAAGTGCAACAAGTCGCTTCTACTAAACGTGTGAAGAATTGTATAAACGAACTGCGAGAAAGGGTT
GCCAGCGGAGTTGATCCAAACAAGTTATACGAAAAGCCAGAAGAAAATACCGGTCCTTATGATGATCAAGATATGGATCA
GCCAGGTCAGGAAGAAGAGAACATACCATCAAAGAGCGCTGATGCTGATACAAATGCTGATGCTTTTGAAGACAGTATGT
TGAATGAGATCTTTGATAGTGCTTCACAGCTACCGAGCGATGAACAAATCCTGGATAAAAGCAGTGAACTGACAGAAGAG
CAAAGAGCACGTATGGAAGCTAATAGATTGAAGGCAATGGAGAAAGCTCAGAACATTTCCGAGGAACAAAGAGTACGTAT
GGAAGCTAATAGGCTAAAGGCTCTTGAAAGAGCCAAAGCAAGGCTCCAACCAAATCAAGATTAG