Details for Lyrate rockcress Locus 16050725

Position : sca3 ( 5`- 2275120 .. 2275392 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16050725

Protein [Map View]
MGGNKRSHSSKRFSLFSFFKTRRSHRVEVDGSWDDVGYTRKAMASDEDKRYWVAEPGIDRKASAFIAKFHATRVSESERQ
TLSPYRSDKA*

DNA
ATGGGTGGAAACAAAAGGTCTCACAGTAGCAAGAGGTTCTCTCTATTCAGCTTCTTCAAAACACGAAGATCTCACAGAGT
GGAAGTAGACGGCTCATGGGACGACGTCGGTTACACTCGCAAGGCAATGGCTAGTGATGAGGACAAACGTTATTGGGTCG
CTGAACCAGGCATCGACCGTAAAGCTTCTGCCTTCATCGCCAAGTTTCATGCGACTCGTGTCTCTGAGTCTGAGCGTCAG
ACTCTCTCTCCTTACCGATCCGACAAGGCATGA