Details for Lyrate rockcress Locus 16050722

Position : sca3 ( 5`- 5003074 .. 5001489 -3` )
Annotation : [B2G] basic endochitinase
External links : CoGe
PGDD synteny : 16050722

Protein [Map View]
MPSKKEYHKTLNKMKTNLFLFLIISLLLSFSSAEQCGRQAGGALCPNGLCCSEFGWCGDTEPYCKQPGCQSQCTPGGTPG
PTGDLSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFPGFGTTGDTATRKKEVAAFFGQTSHETTGGWASAPD
GPFSWGYCFKQEQNPGSDYCEPSATWPCASGKRYYGRGPMQLSWNYNYGLCGRAIGVDLLNNPDLVANDAVIAFKAAIWF
WMTAQPPKPSCHAVIAGQWQPSDADRAAGRLPGYGVITNIINGGLECGRGQDGRVADRIGFYQRYCTIFGVNPGGNLDCY
NQRPFGNGLLNAAI*

DNA
ATGCCTTCAAAAAAAGAATACCATAAAACATTGAACAAAATGAAGACTAATCTTTTTCTCTTTCTCATCATCTCACTTCT
CTTATCATTTTCCTCAGCCGAGCAATGTGGTCGCCAAGCTGGAGGAGCACTCTGCCCCAACGGTCTATGCTGCAGCGAGT
TCGGATGGTGCGGTGACACCGAACCCTACTGTAAGCAGCCTGGCTGCCAAAGCCAGTGCACTCCCGGCGGTACTCCTGGA
CCCACCGGCGATCTTTCGGGCATCATTTCAAGTTCTCAGTTCGATGATATGCTTAAGCATAGGAATGATGCTGCTTGTCC
TGCTAGAGGTTTCTACACTTACAACGCCTTCATCACCGCTGCAAAGTCCTTCCCCGGTTTTGGCACCACCGGAGACACCG
CCACGAGAAAGAAGGAGGTCGCCGCCTTCTTCGGCCAGACTTCCCATGAAACCACAGGTGGGTGGGCTTCAGCACCAGAC
GGACCATTTTCATGGGGCTACTGTTTCAAGCAAGAACAGAATCCTGGTTCAGACTACTGTGAACCAAGCGCCACGTGGCC
ATGCGCATCTGGCAAACGGTACTACGGAAGAGGACCGATGCAGCTGTCGTGGAACTACAATTACGGTCTATGTGGTAGAG
CCATAGGAGTTGACTTACTCAACAACCCCGACCTCGTAGCCAACGACGCAGTGATCGCTTTCAAAGCCGCGATTTGGTTC
TGGATGACTGCTCAGCCTCCGAAACCATCGTGCCACGCGGTGATAGCCGGCCAATGGCAGCCGTCAGACGCCGACCGTGC
AGCCGGGAGATTACCCGGTTATGGAGTGATTACGAACATCATTAACGGTGGATTGGAATGTGGACGTGGCCAAGACGGGA
GAGTCGCGGATCGTATAGGGTTTTATCAGAGGTATTGTACCATATTTGGGGTTAATCCTGGTGGTAATCTTGATTGTTAC
AACCAAAGACCCTTTGGTAACGGCCTCCTCAACGCCGCTATCTAA