Details for Lyrate rockcress Locus 16050715

Position : sca3 ( 5`- 2434006 .. 2435429 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16050715

Protein [Map View]
MSHIAVERNRRRQMNEHLKSLRSLTPCFYIKRGDQASIIGGVIEFIKELQQLVQVLESKKRRKTLNRPSFPHDHQTIEPS
SLGGAATTRVPFSRIENVMTTSTFKEVGACCNSPHANVEAKISGSNVVLRVVSRRIVGQLVKIISVLEKLSFQVLHLNIS
SMEETVLYFFVVKIGLECHLSLEELTLEVQKSFVSEMIVSTN*

DNA
ATGTCTCACATCGCTGTTGAAAGGAATCGAAGAAGGCAGATGAACGAGCATCTTAAATCCCTTCGTTCTTTGACTCCTTG
TTTCTACATCAAAAGGGGAGATCAAGCTTCGATCATCGGAGGAGTGATCGAGTTCATCAAAGAGTTGCAGCAATTGGTGC
AAGTTCTTGAGTCTAAGAAACGTCGAAAGACACTAAACCGACCTTCTTTCCCTCATGATCACCAAACAATCGAGCCATCC
AGTTTAGGCGGCGCAGCCACCACCCGAGTACCGTTTAGTCGAATCGAAAATGTGATGACTACAAGTACTTTCAAGGAAGT
AGGAGCATGCTGTAATTCCCCTCATGCTAACGTAGAAGCCAAGATCTCTGGTTCTAACGTTGTATTGAGAGTTGTCTCTA
GGCGAATCGTGGGCCAGCTCGTTAAGATCATCTCTGTCTTAGAGAAGCTATCTTTTCAAGTTCTTCACCTCAATATTAGT
AGCATGGAGGAGACTGTCTTATACTTTTTCGTTGTTAAGATAGGATTGGAGTGTCACTTAAGCTTGGAGGAGCTAACTCT
TGAAGTTCAGAAAAGCTTTGTGTCAGAAATGATCGTCTCTACCAATTAA