Details for Lyrate rockcress Locus 16050697

Position : sca3 ( 5`- 8417242 .. 8419303 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479462 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16050697

Protein [Map View]
MATSLNLSSIFSSSRLVTTPSSVFPIRQRRRIILVTSSSSGGKPTILVTEKLGQAGIDLLKKYANVDCSYDLSLEELCTK
ISLCDALIVRSGTKVGRDVFESSRGRLKVVGRAGVGIDNVDLAAATEYGCLVVNAPTANTVAAAEHGIALLTAMARNIAQ
ADASIKAGKWTRNKYVGVSLVGKTLAVLGFGKVGSEVARRARGLGMHVITHDPYAPADRARAIGVELVSFEVAISTADFI
SLHLPLTAATSKMMNDVTFSMMKKGVRIVNVARGGVIDEEALLRALDSGIVAQAALDVFTVEPPVKDNKLVLHESVTATP
HLGASTMEAQEGVAIEVAEAVIGALRGELAATAVNAPMVPLEVLRELKPYVVLAEKLGRLAVQLVTGGSGVNAVKVTYAS
SRAPDDLDTRLLRAMVIKGLIEPISSVFINLVNSDYIAKQRGVKISEERMVLDGSPENPIEYITVRIANVESRFASALSE
SGEIKVEGRVKQGIPSLTKVGLFGVDVSLEGSVILCRQVDQPGMIGKVASILGDENVNVSFMSVGRIAPGKQAVMAIGVD
EQPSKETLKKIGDIPAIEEFVFLKL*

DNA
ATGGCGACGTCTCTGAATCTATCATCGATCTTCTCCTCCTCAAGGCTCGTCACCACTCCCTCCTCTGTTTTTCCCATCCG
TCAGAGACGACGGATCATCCTCGTTACGTCTTCTTCTTCCGGAGGAAAACCGACGATTCTAGTGACGGAGAAGCTAGGAC
AAGCGGGGATTGATCTGCTGAAGAAGTACGCTAATGTGGATTGCTCTTATGATCTGAGTCTCGAGGAGCTTTGCACGAAG
ATCTCGCTTTGTGATGCGCTCATCGTCAGGAGTGGTACTAAGGTTGGGAGAGATGTGTTTGAATCGTCGCGTGGGAGGCT
TAAGGTTGTGGGACGAGCTGGTGTTGGGATTGATAATGTTGATTTGGCGGCTGCGACGGAGTATGGTTGTTTGGTTGTCA
ATGCTCCGACTGCTAACACGGTGGCTGCTGCTGAGCACGGGATTGCGCTTCTAACCGCCATGGCTAGGAATATTGCTCAA
GCTGATGCTTCTATCAAAGCTGGCAAATGGACGAGAAACAAATATGTAGGTGTTTCACTTGTGGGGAAGACTCTTGCTGT
TCTTGGTTTTGGTAAAGTTGGATCAGAGGTTGCTAGACGAGCCAGGGGACTTGGGATGCATGTCATTACACATGATCCTT
ATGCACCAGCGGATCGTGCACGAGCCATTGGTGTGGAGCTTGTTAGTTTTGAAGTAGCTATTTCAACTGCAGACTTCATC
TCTTTGCATTTGCCTCTTACTGCTGCTACTTCGAAGATGATGAATGATGTAACCTTTTCGATGATGAAGAAAGGAGTGCG
TATTGTTAATGTTGCTCGTGGTGGAGTTATTGATGAGGAAGCTCTTTTGAGAGCGCTTGATTCGGGTATTGTTGCTCAGG
CAGCTCTTGATGTTTTCACAGTGGAGCCACCTGTTAAAGACAATAAGTTGGTGCTACATGAGAGTGTTACTGCCACGCCT
CATCTTGGTGCTAGTACCATGGAGGCTCAGGAAGGAGTGGCTATCGAAGTTGCAGAAGCTGTTATTGGTGCTTTGAGAGG
AGAACTTGCTGCTACTGCGGTCAATGCACCAATGGTTCCACTAGAGGTATTGAGGGAGTTGAAACCGTATGTTGTGCTCG
CTGAGAAGCTTGGTAGGCTGGCTGTACAACTGGTAACCGGTGGAAGCGGTGTGAATGCTGTGAAAGTGACTTATGCTTCT
TCCAGAGCTCCTGATGATCTCGACACTAGACTTCTTCGTGCCATGGTCATAAAGGGACTCATCGAACCCATTTCCAGTGT
ATTCATAAATCTTGTTAACTCCGATTACATTGCCAAACAACGTGGAGTCAAAATCTCAGAGGAACGTATGGTTCTAGACG
GCTCACCCGAGAATCCAATTGAATACATAACTGTTCGGATCGCAAACGTGGAATCAAGATTCGCCAGCGCGTTATCAGAG
TCCGGTGAGATCAAAGTAGAAGGCAGAGTGAAACAAGGGATTCCAAGTCTAACCAAAGTGGGCTTATTTGGAGTGGATGT
GAGTTTAGAAGGGAGTGTGATTCTGTGCAGGCAAGTAGATCAGCCCGGGATGATCGGTAAAGTTGCTAGCATCTTAGGAG
ATGAAAACGTGAACGTGAGCTTCATGAGCGTCGGTCGAATCGCTCCAGGCAAGCAAGCGGTAATGGCAATTGGAGTAGAT
GAACAACCAAGCAAAGAAACTTTGAAGAAAATCGGAGACATTCCTGCCATTGAAGAGTTTGTTTTCCTCAAACTATAG