Details for Lyrate rockcress Locus 16050689

Position : sca3 ( 5`- 1051584 .. 1052735 -3` )
Annotation : [B2G] ku70-binding family protein
External links : CoGe
PGDD synteny : 16050689

Protein [Map View]
MEDAAAPNSGSEFNPGARRGKSIDECQDMIRRSFRNPIVKFLMEQMEKSGCRVGDNFVKAVVCTGPVAGGYTKGRGITVC
SNYLTIQDEVNQVVIHELIHAYDECRAKNLDWTNCAHHACSEVIRAGHLSGDCHFKRELLRGFIKLRGHEQECIKRRVLK
SLRGNPYCSEVAAKDAMEAVWDTCYNDTKPFDRAP*

DNA
ATGGAAGATGCAGCTGCTCCGAATTCTGGATCCGAATTTAACCCAGGAGCAAGACGCGGCAAATCTATCGATGAATGCCA
AGACATGATTCGTAGGAGTTTCCGAAACCCAATTGTGAAGTTTCTCATGGAGCAAATGGAGAAATCTGGGTGTAGAGTTG
GTGATAATTTCGTTAAGGCTGTTGTTTGTACTGGACCTGTAGCTGGAGGTTACACTAAAGGGAGAGGGATTACTGTCTGC
AGTAACTATTTGACCATTCAAGACGAAGTGAACCAAGTAGTTATACATGAGTTGATTCATGCTTATGACGAGTGCCGAGC
CAAGAATTTGGATTGGACTAATTGTGCTCATCATGCTTGCAGCGAGGTGATTCGTGCAGGTCATCTAAGCGGTGATTGCC
ATTTCAAGAGAGAACTTTTGCGGGGTTTCATTAAATTAAGAGGGCATGAACAAGAATGTATAAAAAGAAGAGTGTTGAAA
TCTCTTCGTGGCAACCCGTATTGCTCGGAAGTAGCTGCTAAAGATGCGATGGAAGCAGTGTGGGATACTTGTTACAATGA
CACTAAGCCTTTTGATAGAGCTCCTTGA