Details for Lyrate rockcress Locus 16050677

Position : sca3 ( 5`- 4955248 .. 4956867 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478591 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16050677

Protein [Map View]
MASSSDHTAKIIDGKAIAHTIRSEIAEEVRGLSEKHGKVPGLAVVIVGNRKDSQTYVNTKRKACAEVGIKSFDVGLPEEV
SEADLISKVHELNSNPDVHGILVQLPLPKHINEENVLGAISIDKDVDGFHPLNIGKLAMKGREPLFLPCTPKGCLELLAR
SGVKIKGQRAVVVGRSNIVGLPVSLLLLKADATVTTVHSHTKDPEAFIREADIVIAACGQAHMIKGNWIKPGAAVIDVGT
NAVSDPSKKSGYRLVGDVDFAEASKVAGFITPVPGGVGPMTVAMLLRNTVDGAKRVFGE*

DNA
ATGGCGTCATCATCTGATCACACGGCGAAGATAATCGACGGAAAGGCGATTGCTCATACCATCCGATCAGAGATCGCCGA
GGAAGTTCGCGGTCTATCTGAGAAACACGGCAAGGTCCCAGGACTAGCTGTAGTTATTGTTGGGAACCGAAAGGATTCAC
AGACCTATGTGAATACGAAGAGGAAAGCATGCGCTGAGGTTGGGATTAAGTCATTTGATGTGGGCCTACCAGAGGAAGTT
TCTGAAGCTGATCTTATAAGCAAAGTTCATGAACTAAATTCTAATCCGGATGTCCATGGCATATTAGTTCAACTCCCATT
GCCGAAACATATTAATGAGGAGAATGTTTTGGGTGCAATCAGCATTGATAAAGATGTCGATGGCTTCCATCCTTTGAATA
TTGGTAAGCTAGCCATGAAAGGCAGAGAACCCCTCTTCCTTCCTTGCACCCCAAAGGGATGCTTGGAACTCTTAGCCAGA
AGTGGGGTAAAGATAAAGGGGCAACGAGCAGTTGTTGTAGGTCGGAGTAATATCGTTGGTTTACCTGTTTCGCTTCTATT
GCTCAAGGCTGATGCTACTGTTACAACTGTACATTCTCACACCAAGGATCCTGAGGCTTTCATACGGGAAGCTGACATCG
TTATTGCTGCTTGCGGACAAGCCCACATGATTAAGGGCAACTGGATAAAGCCAGGGGCTGCGGTAATCGATGTTGGAACT
AACGCAGTCAGCGACCCAAGCAAGAAATCAGGATACCGGTTGGTTGGAGATGTCGATTTTGCAGAAGCTTCTAAAGTTGC
AGGTTTCATAACTCCGGTCCCTGGTGGTGTAGGCCCAATGACAGTCGCAATGCTTCTCAGGAACACCGTAGACGGTGCCA
AGCGTGTCTTTGGCGAGTAA