Details for Lyrate rockcress Locus 16050652

Position : sca3 ( 5`- 9080271 .. 9074138 -3` )
Annotation : [B2G] ubiquitin-specific protease 14
External links : CoGe
PGDD synteny : 16050652

Protein [Map View]
MELLRSNLSRVQIPEPTHRIYKHECCISFDTPRSEGGLFVDMNSFLAFGKDYVSWNYEKTGNPVYLHIKQTTKSIPEDRP
LKKPTLLAIGVDGGFDNNEPEYEESYSIVILPDFVSLPFPSVELPEKVRIAVDTVVNAVGAERKEQVAAWTAEKKLVSEH
ALTLQQIKSGIVIPPSGWKCAKCDKTENLWLNLTDGMILCGRKNWDGTGGNNHAVEHYKETAYPLAVKLGTITADLEAAD
VYSYPEDDSVLDPLLAEHLAHFGIDFSSMQKTEMTTAERELDQNTNFDWNRIQESGKELVPVFGPGYTGLVNLGNSCYLA
ATMQIVFSNHSFISRYFSHQSLKMAFEMAPADPTLDLNMQLTKLGHGLLSGKYSIPATQKDATTGDARQEGIPPRMFKNV
IAASHAEFSSMRQQDALEFFLHLVGKVERASNTTPDLDPSRSFKFGIEEKILCPSGKVGYNKREDCILSLNIPLHEATNK
DELEAFNKQKAGKGLEENDIRSSDEIVRPRVPLEACLANFASSEAIDDYYSSALKGRTTAIKTTGLTSFPDYLVLHMRKF
VMEAGWVPKKLDVYIDVPDVIDISHMRSKGLQPGEELLPDGVPEEVIESAQPVANEEIVAQLVSMGFSQLHCQKAAINTS
NAGVEEAMNWLLSHMDDPDIDAPISHQTSDVDQSSLDALLSFGFAEDVARKALKASGGDIEKATDWIFNNPNASVSDMDV
SSSNSAQTPAQSGLPDGGGKYKLFGIVSHMGTSVHCGHYVAHILKEGRWVIFNDDKVGISTDPPKDMGYVYFFQRLD*

DNA
ATGGAGCTCCTCCGATCCAACTTGTCTAGGGTTCAGATCCCTGAACCTACTCATCGCATCTACAAGCATGAGTGTTGCAT
CTCCTTCGATACTCCGAGATCCGAAGGAGGATTGTTCGTAGATATGAATAGTTTTCTTGCTTTTGGGAAGGATTATGTTT
CTTGGAATTATGAGAAGACTGGAAACCCTGTTTATCTGCATATTAAGCAGACCACCAAGTCTATTCCTGAGGATCGCCCT
CTCAAGAAACCGACTCTGCTCGCTATAGGAGTTGATGGAGGATTTGATAACAATGAGCCTGAGTACGAGGAGTCGTATAG
CATAGTCATTCTTCCGGATTTTGTGTCACTTCCGTTTCCTTCTGTTGAACTACCAGAGAAGGTGAGGATTGCTGTCGATA
CTGTAGTGAATGCCGTAGGTGCTGAGCGGAAAGAGCAAGTTGCAGCTTGGACAGCTGAGAAAAAGTTAGTTAGTGAACAT
GCATTGACACTGCAGCAAATCAAGAGTGGCATTGTCATTCCTCCCTCTGGTTGGAAATGTGCCAAGTGTGATAAGACGGA
GAATCTCTGGCTTAATCTTACCGATGGAATGATTCTCTGTGGAAGAAAAAACTGGGATGGAACTGGTGGAAACAACCATG
CGGTTGAGCACTACAAAGAGACAGCCTACCCTCTTGCTGTAAAGCTTGGAACTATCACAGCTGACTTAGAAGCAGCAGAT
GTTTATTCCTATCCGGAAGATGACAGTGTTTTGGACCCGCTCCTGGCTGAGCATCTGGCCCATTTTGGAATTGACTTTTC
GTCGATGCAGAAGACTGAAATGACAACTGCCGAAAGAGAACTTGATCAAAATACAAATTTTGATTGGAACCGTATACAAG
AGAGTGGAAAAGAATTGGTACCAGTTTTTGGACCTGGATATACCGGACTTGTTAATCTTGGGAACAGTTGCTACTTGGCA
GCTACGATGCAGATTGTTTTCTCTAACCATTCATTTATTTCAAGATACTTTTCACATCAGAGCTTAAAGATGGCTTTTGA
GATGGCTCCTGCTGATCCAACTTTGGACCTCAATATGCAATTAACAAAGCTTGGACATGGTTTACTATCTGGGAAGTACT
CTATTCCTGCAACTCAGAAGGATGCTACAACTGGAGATGCTAGACAAGAAGGAATACCTCCTCGCATGTTCAAAAACGTA
ATTGCTGCGAGCCACGCAGAATTCTCTTCTATGAGACAGCAGGATGCGCTCGAGTTTTTTCTCCATTTGGTAGGCAAGGT
TGAGCGTGCTAGCAACACGACACCAGATTTAGATCCCTCGAGGAGCTTCAAGTTTGGAATAGAAGAGAAGATCCTTTGTC
CATCTGGAAAGGTTGGATATAATAAGAGGGAAGACTGTATTCTTTCTTTGAACATTCCGCTGCATGAGGCAACTAATAAA
GATGAATTAGAAGCCTTTAACAAGCAGAAAGCAGGAAAAGGATTGGAAGAAAATGATATCAGGTCAAGTGATGAAATAGT
ACGCCCACGAGTTCCTTTAGAAGCTTGTCTAGCAAATTTTGCATCATCAGAGGCGATTGATGACTACTACAGCTCTGCTC
TGAAGGGGAGGACAACAGCTATCAAGACAACTGGTTTGACATCTTTCCCAGATTATTTGGTCTTGCACATGCGGAAGTTT
GTTATGGAGGCAGGCTGGGTGCCAAAAAAACTTGATGTATACATTGATGTTCCGGATGTTATTGATATCAGCCACATGCG
TAGCAAAGGACTCCAACCTGGGGAGGAACTGTTGCCAGATGGCGTTCCAGAAGAAGTGATTGAATCAGCGCAGCCTGTGG
CAAATGAGGAGATAGTTGCACAACTTGTCTCAATGGGATTTAGCCAGCTTCATTGCCAGAAAGCTGCCATAAATACTTCC
AATGCTGGGGTTGAAGAGGCAATGAACTGGTTACTTTCTCACATGGATGATCCAGACATTGATGCACCGATCTCCCACCA
GACATCTGACGTTGATCAATCAAGCCTTGATGCCTTACTCTCTTTTGGTTTTGCTGAAGATGTTGCTCGAAAGGCACTAA
AGGCCTCGGGAGGAGATATAGAGAAAGCAACAGATTGGATATTCAACAACCCTAATGCATCTGTTTCAGACATGGATGTT
TCCTCTAGCAATTCAGCGCAGACTCCGGCTCAAAGTGGATTACCAGATGGAGGAGGGAAATACAAGCTGTTTGGAATAGT
AAGTCACATGGGAACATCAGTGCACTGTGGTCACTACGTGGCGCACATATTGAAAGAAGGTCGTTGGGTTATTTTCAATG
ACGACAAAGTTGGTATCTCGACTGATCCTCCTAAAGACATGGGTTATGTCTACTTCTTTCAGCGGCTTGATTGA