Details for Lyrate rockcress Locus 16050646

Position : sca3 ( 5`- 4480720 .. 4480330 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16050646

Protein [Map View]
MGARFLVQGTGVTLGWISGYYLYGGQLDKYEEKRQQIVMDVFGNPAEIEDLRKKMWPELRKMAWFRSLDKKWSDYKSKS*

DNA
ATGGGAGCTAGGTTCTTAGTTCAAGGTACAGGAGTGACTTTGGGATGGATCTCAGGTTATTATTTGTATGGAGGTCAATT
AGATAAATATGAGGAGAAGCGGCAACAGATTGTGATGGACGTTTTTGGGAATCCTGCGGAAATCGAGGATCTGAGGAAGA
AAATGTGGCCTGAGTTAAGGAAGATGGCGTGGTTTAGAAGTTTGGACAAGAAGTGGTCTGACTATAAATCGAAATCCTAA