Details for Lyrate rockcress Locus 16050644

Position : sca3 ( 5`- 9704811 .. 9704440 -3` )
Annotation : [B2G] zinc finger (b-box type) family protein
External links : CoGe
PGDD synteny : 16050644

Protein [Map View]
MCRGLIFNEEESRRSHGDGCRSLCTRPSVPVRCELCGGDASVFCEADSAFLCRKCDRWVHGANFLAWRHVRRVLCTSCQK
LTRRCLVGDHDFHVVLPSVTTVGEATVESRSEQDNHEVPFVFL*

DNA
ATGTGTAGAGGCTTGATCTTTAATGAAGAAGAGAGCAGAAGAAGCCACGGTGATGGTTGCCGGAGTCTTTGCACGAGACC
GAGTGTTCCGGTTAGGTGTGAGCTTTGTGGCGGCGATGCCTCCGTGTTCTGTGAGGCTGACTCGGCGTTTCTCTGTAGAA
AATGTGACCGGTGGGTTCATGGAGCGAATTTTCTAGCTTGGAGACACGTAAGGCGCGTGCTATGCACTTCTTGTCAGAAA
CTCACGCGCCGGTGCCTCGTCGGAGATCATGACTTCCACGTTGTTTTACCGTCGGTGACGACGGTGGGAGAAGCCACCGT
GGAGAGTAGAAGTGAACAAGATAATCATGAGGTTCCGTTTGTATTTCTCTGA