Details for Lyrate rockcress Locus 16050581

Position : sca3 ( 5`- 12417376 .. 12415625 -3` )
Annotation : [B2G] fata acyl-acp thioesterase
External links : CoGe
PGDD synteny : 16050581

Protein [Map View]
MLKLSCNVTDSKLQRSLLFFSHSHRSDPVNFIRRRIVSCSQTKKTGLVPLRAVVSTDQGTVIQGLGTLADQLRLGSLTED
GLSYKEKFVVRSYEVGSNKTATIETIANLLQEVGCNHAQSVGFSTDGFATTPTMRKLHLIWVTARMHIEIYKYPAWGDVV
EIETWCQSEGRIGTRRDWILKDCVTGEVTGRATSKWVMMNQDTRRLQKVSDDVRDEYLVFCPQELRLAFPEENNRSLKKI
PKLEDPAQYSMIGLKPRRADLDMNQHVNNVTYIGWVLESIPQEIVDTHELQVITLDYRRECQQDDVVDSLTTSEIGGTNG
SATSGKQGHNDSQFLHLLRLSGDGQEINRGTTLWRKKPSR*

DNA
ATGTTGAAGCTTTCGTGTAATGTGACTGATTCTAAGTTACAGAGAAGCTTATTGTTCTTCTCGCATTCTCATCGATCTGA
TCCGGTGAATTTCATTCGTCGGAGAATCGTCTCTTGTTCTCAGACGAAGAAGACGGGTTTGGTTCCTTTGCGTGCGGTTG
TATCTACTGATCAAGGAACTGTGATTCAAGGTTTGGGTACGCTCGCGGATCAGCTCCGATTAGGTAGTTTGACGGAAGAT
GGTTTATCTTATAAAGAGAAGTTTGTTGTTAGATCTTACGAAGTTGGAAGTAACAAAACCGCTACCATTGAAACCATTGC
TAATCTTTTACAGGAGGTGGGATGTAATCATGCACAAAGTGTTGGATTTTCGACTGATGGATTTGCAACAACACCAACTA
TGAGGAAATTGCATCTCATTTGGGTTACTGCAAGAATGCACATTGAGATCTACAAATACCCTGCTTGGGGTGATGTGGTT
GAGATAGAGACATGGTGTCAGAGTGAAGGAAGGATTGGGACAAGGCGTGATTGGATTCTTAAGGATTGTGTTACTGGTGA
AGTCACTGGCCGTGCTACAAGCAAGTGGGTGATGATGAACCAAGACACAAGACGGCTTCAGAAAGTTTCTGATGATGTTC
GGGACGAGTACTTGGTCTTCTGTCCTCAAGAACTAAGATTAGCATTTCCGGAAGAGAATAACAGAAGCTTGAAGAAAATC
CCGAAACTCGAAGATCCGGCTCAGTATTCAATGATTGGGCTTAAGCCTAGACGAGCTGATCTCGACATGAACCAGCATGT
CAATAATGTCACCTATATTGGATGGGTTCTCGAGAGCATACCACAAGAAATTGTAGACACGCACGAGCTTCAGGTCATAA
CTCTGGATTACAGAAGAGAATGTCAACAAGACGATGTGGTGGATTCGCTTACCACTTCTGAAATTGGTGGAACCAATGGC
TCTGCCACGTCTGGCAAACAGGGCCACAACGATAGCCAGTTCTTGCACCTCCTGAGGTTGTCTGGAGATGGTCAGGAGAT
CAACCGCGGGACAACCCTGTGGAGAAAGAAGCCGTCAAGATAA