Details for Lyrate rockcress Locus 16050557

Position : sca1 ( 5`- 29178051 .. 29175361 -3` )
Annotation : [B2G] kinase family protein
External links : CoGe
PGDD synteny : 16050557

Protein [Map View]
MSREKQEKRSGSNGTEKVLVAVKASREISKTALVWALTHIVHPGDCITLIVVVTSHNAGRKLWTFPRFAGDCATGHRKLH
SDAIPEIKSDLTDTCSQMILQLHDVYDPNKVNVRIKIVSGSPCGAVAAEAKKSQANWVVLDKHLEHEKKRCIDELQCNIV
AMKRSQAKFLRLNLVGSPTKQPVLASEKNKNKLLDSVKAVVTSTPMSSPEVETSFTGTEVGTSSVSSSDLGASSPFFTAE
VKKDETLAIKENESDSDSESENVSLPSTSMRFQPWISEYLGTHRLSLQESEESLWKTDDKAAQVSSKKAFLEKISKVDEG
EESAMSSKRNDLEEFSGTLRETISLSRNAPPVSPPLCSICQHKAPVFGKPPRFFSYKELELATNGFSRANFLAEGGFGSV
HRGVLPEGQIVAVKQHKLASTQGDVEFCSEVEVLSCAQHRNVVMLIGFCIEDTRRLLVYEYICNGSLDSHLYGRHKDTLG
WSARQKIAVGAARGLRYLHEECRVGCIVHRDMRPNNILITHDYEPLVGDFGLARWQPDGELGVDTRVIGTFGYLAPEYTQ
SGQITEKADVYSFGVVLVELITGRKAMDIYRPKGQQCLTEWARSLLEEYAVEELVDPRLEKRYSETEVICMIHTASLCIR
RDPHLRPRMSQVLRLLEGDMVMNEISGRFNGD*

DNA
ATGAGCAGAGAGAAACAGGAGAAGAGATCAGGTTCTAATGGGACTGAGAAGGTTCTTGTTGCTGTTAAAGCATCTAGGGA
GATTTCAAAGACAGCATTGGTTTGGGCTTTGACTCATATTGTTCATCCTGGAGATTGCATTACTCTGATTGTTGTTGTCA
CTTCTCATAATGCTGGCCGAAAGCTATGGACTTTCCCGAGGTTCGCTGGAGATTGTGCTACTGGTCATCGGAAACTGCAT
TCTGATGCAATTCCTGAGATAAAGAGTGATCTCACTGATACTTGTTCCCAAATGATTCTCCAGCTTCATGATGTCTATGA
TCCAAACAAGGTTAATGTCAGGATCAAGATTGTTTCTGGATCACCATGTGGAGCTGTTGCGGCTGAGGCCAAGAAATCAC
AAGCAAATTGGGTAGTTCTGGATAAGCACCTTGAGCATGAAAAGAAACGGTGCATAGATGAGCTACAATGTAACATTGTG
GCAATGAAGCGTTCTCAGGCAAAATTTCTGCGCTTGAACTTGGTCGGGTCACCAACGAAGCAACCAGTATTAGCATCTGA
AAAAAACAAAAACAAGTTGTTAGATTCTGTTAAAGCGGTTGTTACATCAACTCCAATGAGCAGTCCTGAGGTTGAGACAT
CATTCACAGGAACAGAAGTTGGGACTTCATCAGTTTCTAGCTCTGACCTCGGAGCATCATCACCTTTTTTCACAGCTGAA
GTGAAAAAGGATGAAACTTTGGCCATCAAAGAGAATGAATCTGATTCTGATTCAGAGAGCGAAAATGTATCACTACCTTC
CACTAGTATGAGATTCCAGCCATGGATATCAGAATATCTTGGCACTCATCGCCTCTCATTGCAGGAATCCGAGGAGAGTC
TGTGGAAAACTGATGATAAGGCTGCTCAAGTATCATCTAAAAAGGCTTTTCTTGAGAAAATTTCTAAGGTTGATGAAGGA
GAAGAATCAGCAATGTCAAGTAAAAGGAATGACTTGGAGGAGTTTAGTGGAACCTTAAGAGAAACAATTTCCTTATCACG
AAATGCTCCTCCTGTTTCTCCTCCTCTATGTTCTATCTGTCAGCACAAAGCGCCTGTATTTGGAAAACCGCCGAGGTTTT
TCTCCTACAAAGAGTTAGAGCTTGCAACAAATGGGTTTTCTCGAGCTAATTTCTTGGCAGAAGGTGGATTTGGATCTGTT
CATAGAGGTGTATTACCTGAAGGCCAGATTGTAGCAGTAAAGCAACACAAACTGGCTAGTACACAAGGAGATGTAGAGTT
TTGCTCTGAAGTAGAAGTTTTGAGCTGTGCTCAGCATCGAAACGTAGTTATGTTAATCGGTTTCTGCATCGAAGATACCA
GAAGACTCTTGGTCTATGAATACATATGCAATGGATCATTAGACTCTCATCTATACGGTCGCCATAAAGACACTTTGGGA
TGGTCTGCAAGGCAAAAAATAGCGGTTGGAGCGGCTCGTGGTCTTCGGTATCTTCATGAAGAGTGTAGAGTGGGTTGCAT
TGTTCATAGAGACATGAGGCCTAACAATATACTAATAACTCATGATTATGAACCACTGGTTGGAGATTTTGGTTTAGCGC
GATGGCAGCCTGATGGAGAGCTCGGTGTAGACACGCGTGTGATAGGAACTTTCGGGTATTTAGCTCCAGAATATACTCAA
AGTGGACAAATCACAGAGAAAGCTGATGTTTACTCATTCGGGGTTGTATTGGTTGAACTAATCACGGGTCGTAAAGCAAT
GGATATCTACAGACCAAAGGGACAACAATGTTTAACTGAATGGGCAAGGTCTTTATTAGAAGAGTATGCAGTTGAGGAAT
TGGTTGATCCGAGGCTCGAGAAGCGATATTCAGAAACCGAAGTCATTTGTATGATTCATACAGCTTCATTGTGTATACGT
AGAGACCCACATTTGCGTCCTCGTATGTCTCAGGTGTTGCGTTTATTGGAAGGAGATATGGTAATGAATGAAATCTCAGG
CAGGTTTAACGGAGATTGA