Details for Lyrate rockcress Locus 16050335

Position : sca5 ( 5`- 17901327 .. 17899852 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_324152 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16050335

Protein [Map View]
MTTTVIISIFLAIFATSLQNARGATMEPCLESMKTASLPDLPYAYDALEPAISEEIMRLHHQKHHQTYVTQYNKALNSLR
SAMADGDHSSVVKLQSLIKFNGGGHVNHAIFWKNLAPVHEGGGKPPHDPLSSAIDAHFASLEGLIQKMNAEGAAVQGSGW
VWFGLDRELKRLVVETTANQDPLVTKGSHLVPLIGIDVWEHAYYPQYKNARAEYLKNIWTVINWKYASDVFEKHTRDLDI
N*

DNA
ATGACGACCACCGTCATTATCAGTATCTTCCTTGCGATCTTCGCTACGAGTCTTCAAAACGCCAGAGGAGCAACCATGGA
ACCGTGTCTCGAATCAATGAAGACTGCTTCACTTCCTGATCTTCCGTACGCTTATGATGCGTTAGAGCCAGCGATCAGTG
AGGAGATCATGCGGCTACACCACCAGAAACACCACCAGACTTATGTCACTCAGTACAACAAAGCCCTTAACAGCCTTCGC
TCTGCCATGGCCGACGGTGATCACTCCTCCGTCGTCAAACTCCAAAGCCTCATCAAGTTCAACGGCGGAGGTCACGTTAA
CCATGCAATCTTCTGGAAAAACCTAGCCCCTGTTCATGAAGGAGGTGGCAAGCCACCGCACGATCCTTTGTCTTCGGCGA
TCGATGCTCATTTCGCATCATTAGAGGGATTGATCCAAAAGATGAACGCGGAAGGCGCTGCCGTGCAGGGATCTGGATGG
GTGTGGTTTGGATTAGACAGAGAGCTAAAGAGACTTGTCGTTGAGACCACAGCCAATCAGGACCCATTGGTGACGAAGGG
ATCACACTTAGTTCCTCTAATCGGGATTGACGTGTGGGAGCATGCCTACTATCCACAGTACAAGAATGCTAGAGCGGAGT
ACTTGAAGAACATATGGACTGTGATCAACTGGAAATATGCCTCGGACGTATTCGAGAAGCACACTCGTGATCTTGATATT
AACTGA