Details for Lyrate rockcress Locus 16050252

Position : sca3 ( 5`- 3969230 .. 3971089 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16050252

Protein [Map View]
MKEMQAIETSQPTTVAPAVHSRQLGAQLSGSMSFSSQMSKEDEEMSRTALSAFRAKEEEIEKKKMEIRERVQAQLGRVEE
ETKRLALIREELEGLADPMRKEVALVRKKIDSVNKELKPLGHTVQKKEREYKEALEAFNEKNREKVQLITRLMELVGESE
KMRMKKLEELSKNIDSIH*

DNA
ATGAAGGAGATGCAGGCAATAGAGACGTCGCAGCCGACGACGGTGGCTCCGGCGGTGCATAGCCGACAATTGGGAGCTCA
GTTGTCGGGAAGTATGAGTTTCAGCAGCCAAATGTCGAAGGAAGACGAGGAGATGTCTAGGACTGCGTTATCTGCGTTTA
GAGCGAAAGAAGAAGAGATCGAGAAGAAGAAGATGGAGATTAGGGAAAGGGTTCAAGCTCAGCTTGGTCGTGTTGAAGAA
GAGACTAAGCGTCTTGCTTTGATCCGTGAGGAACTTGAAGGTTTAGCTGATCCCATGAGGAAAGAAGTTGCTTTGGTTAG
GAAGAAGATTGATTCTGTCAACAAAGAATTAAAGCCATTGGGGCATACAGTTCAGAAAAAGGAACGAGAGTACAAAGAAG
CTCTTGAAGCATTCAACGAAAAGAACAGGGAGAAGGTGCAGCTAATCACCAGGCTAATGGAGTTGGTGGGAGAAAGCGAA
AAGATGAGAATGAAGAAGCTGGAAGAGCTAAGCAAGAACATAGATTCTATACACTGA