Details for Lyrate rockcress Locus 16050241

Position : sca3 ( 5`- 8747545 .. 8743434 -3` )
Annotation : [B2G] arginine n-methyltransferase family protein
External links : CoGe
PGDD synteny : 16050241

Protein [Map View]
MQSGGDFSNGFHGDQHRELELEDKQVPGLSSFGRAKRRSHAGARDPRGGLANVLRVSDQLGEQKSLETSESSPPPCTDFD
VAYFHSYAHVGIHEEMIKDRARTETYREAIMQHQSLIQGKVVVDVGCGTGILSIFCAQAGAKRVYAVDASDIAVQAKEVV
KANGLSEKVIVLHGRVEDVEIDEEVDVIISEWMGYMLLYESMLGSVITARDRWLKPGGLILPSHATLYMAPVSHPDRYSH
SIDFWRNVYGIDMSAMMQLAKQCAFEEPSVESISGENVLTWPEVVKHIDCQTIKIQELDSVTARYKFNSMMRAPMHGFAF
WFDVEFSGPTSLPAKNTSETSVASGSSSISPSGEVNQKKRTNPSDALVLSTSPEAPPTHWQQTIVYFYDPIDVEQDQVIE
GSVTLSQSKENRRFMNIHLEYSSAGRSFVKESVMR*

DNA
ATGCAATCTGGCGGCGATTTCAGCAATGGTTTCCACGGCGACCAACACCGCGAGCTTGAATTGGAAGACAAGCAAGTCCC
CGGTCTCAGCTCTTTTGGCCGAGCCAAAAGGCGCAGTCACGCCGGAGCTCGTGACCCTAGAGGCGGTCTCGCCAATGTGC
TTAGGGTTTCTGACCAGCTTGGGGAGCAGAAGTCATTGGAGACTTCGGAATCTTCTCCTCCGCCTTGTACTGACTTCGAC
GTTGCCTACTTTCATTCCTATGCTCACGTTGGGATTCACGAAGAGATGATCAAGGACCGGGCAAGGACGGAAACTTATAG
GGAAGCCATAATGCAGCACCAGAGCTTAATTCAAGGCAAGGTCGTGGTGGACGTTGGCTGTGGAACAGGCATCCTTTCAA
TCTTCTGTGCCCAAGCAGGAGCAAAGCGGGTATATGCTGTAGATGCAAGTGATATTGCTGTCCAGGCAAAGGAAGTTGTG
AAAGCCAACGGTTTATCCGAGAAGGTCATTGTCTTGCATGGGAGAGTGGAGGATGTTGAAATCGACGAGGAGGTTGATGT
TATAATTTCAGAGTGGATGGGTTACATGCTCTTGTATGAGAGCATGCTGGGAAGTGTTATTACAGCTAGAGATCGCTGGT
TGAAGCCTGGAGGTTTAATTCTCCCATCACATGCAACATTATACATGGCACCTGTTTCACACCCTGACAGATACAGTCAC
AGCATTGATTTTTGGCGCAATGTTTATGGAATCGATATGTCTGCCATGATGCAATTAGCTAAACAGTGTGCGTTTGAAGA
ACCCAGTGTAGAGTCCATATCAGGCGAGAACGTTCTAACATGGCCAGAAGTGGTTAAACATATAGACTGTCAAACTATAA
AAATCCAAGAGCTAGACTCTGTCACTGCAAGATATAAATTCAACTCAATGATGAGAGCTCCTATGCATGGTTTTGCATTT
TGGTTCGACGTTGAATTCAGCGGACCGACCTCTTTGCCTGCCAAAAATACTAGTGAAACTAGTGTTGCTAGTGGTTCTTC
TTCGATAAGTCCTTCTGGAGAAGTAAATCAGAAGAAGCGGACTAATCCGAGTGATGCACTCGTGTTGTCCACCTCTCCCG
AGGCTCCTCCAACGCATTGGCAGCAAACGATTGTATATTTCTATGACCCTATAGACGTAGAGCAAGACCAAGTCATTGAA
GGTTCCGTGACACTTTCTCAAAGCAAAGAGAACCGGAGATTCATGAACATCCACCTCGAATATTCCTCGGCCGGCCGTTC
CTTTGTAAAAGAGTCAGTAATGCGTTAA