Details for Lyrate rockcress Locus 16050178

Position : sca3 ( 5`- 1791860 .. 1791038 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16050178

Protein [Map View]
MLCFEQKSQTFEAEKSEAGDLKKLVEECTEELRSKRNLLTVRLDSLTRVQRELESKDNQLGQVMAEIKRRCTEARNVQER
KREVEDETASKKKELSLIVEQIEESDKQLENKSREVELKEKDIEENRKELDLVKSQVKAWERKLIQLRKLVDDDCTRELS
PRKDHVDSSNNTHVLLRQSKLLCHHLMLVPSMSPKHPPLFYTHQRKETLKDPEETEEKLRLKGDITN*

DNA
ATGTTGTGTTTTGAGCAAAAGAGTCAAACTTTTGAAGCAGAAAAGTCTGAAGCTGGTGATTTGAAGAAATTGGTGGAAGA
GTGTACTGAAGAACTGAGGTCAAAGAGGAATCTACTGACTGTGAGGCTCGATTCTTTGACAAGGGTTCAGAGAGAGCTTG
AGTCAAAGGATAACCAATTGGGACAGGTTATGGCCGAGATTAAGAGGCGTTGCACTGAGGCTCGTAATGTTCAAGAGCGT
AAGAGAGAAGTGGAAGATGAAACAGCTTCAAAGAAGAAAGAGTTGTCACTGATTGTTGAGCAGATCGAAGAATCTGACAA
ACAGCTTGAGAACAAGTCTCGAGAAGTAGAATTGAAGGAGAAGGACATTGAAGAGAACAGAAAAGAACTTGATTTGGTTA
AGAGTCAAGTCAAAGCATGGGAAAGGAAACTCATTCAGCTTAGGAAATTGGTTGATGATGATTGTACAAGAGAACTAAGT
CCAAGGAAAGATCATGTGGATTCATCGAACAACACTCATGTTTTACTTCGCCAGTCAAAGTTGTTATGTCATCATCTGAT
GTTAGTTCCATCAATGAGCCCCAAGCATCCTCCACTCTTCTACACACACCAGAGGAAAGAAACGCTCAAAGACCCTGAGG
AAACAGAAGAAAAGCTTAGACTCAAAGGAGACATTACTAATTAA