Details for Lyrate rockcress Locus 16050168

Position : sca3 ( 5`- 11067452 .. 11069131 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16050168

Protein [Map View]
MSPFALFLFTFLVLSSSCFSAIGSQNNRTVLALASRIGINYGKLGNNLPSPYQSINLIKTLKAGHVKLYDADPETLKLLS
KTNLYVTIMVPNNQIISIGADQAAADNWVATNVLPYYPQTRIRFVLVGNEILSYNTDQDKQIWANLVPAMRKVVNSLRAR
GIHNIKVGTPLAMDALRSSFPPSSGTFREDIAVPVMLPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNHLDFALFESNSTY
TDPQTGLVYTNLLDQMLDSVIYAMTKLGYPNIPLAISETGWPNSGDIHEIGANILNAATYNRNLIKKMTANPPLGTPARR
GSPIPTFLFSLFNENQKPGSGTERHWGILNPDGTPIYDIDFSGTRSVSSFGTLPKPSNNVPFKGNVWCVAVDGADEAELG
LALNFACGRNNETCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTINPGNERCKFPSVTL*

DNA
ATGTCTCCTTTTGCTCTGTTCCTCTTCACTTTCCTTGTCCTTTCAAGTTCATGTTTCTCTGCGATTGGTTCCCAAAACAA
CAGAACAGTGTTAGCACTTGCAAGCAGAATTGGAATCAACTACGGAAAATTAGGCAACAATCTTCCTTCTCCTTACCAAT
CAATCAACCTCATCAAAACCCTTAAAGCTGGCCACGTCAAGCTCTACGATGCTGATCCAGAAACCCTAAAGCTCCTCTCT
AAGACCAATCTTTACGTCACCATCATGGTCCCTAACAACCAGATCATCTCAATAGGCGCTGATCAAGCCGCTGCTGATAA
CTGGGTCGCCACCAATGTCCTTCCATACTACCCGCAAACCCGAATCCGGTTCGTCCTCGTTGGCAACGAAATCCTCAGCT
ACAATACCGATCAAGACAAGCAAATATGGGCCAATCTTGTCCCTGCCATGCGTAAAGTTGTGAATTCTCTTAGAGCTCGT
GGGATTCACAACATCAAAGTTGGGACTCCTCTTGCCATGGACGCTCTTCGATCGAGTTTTCCTCCGTCGAGTGGTACATT
CCGGGAAGATATCGCGGTTCCGGTGATGTTACCGTTGTTGAAGTTTCTCAATGGAACAAACTCTTTCTTCTTCCTTGATG
TTTACCCTTACTTCCCTTGGTCCACTGATCCGGTTAACAACCATTTGGATTTCGCTCTTTTCGAATCGAATTCGACTTAT
ACCGATCCGCAAACCGGTTTGGTTTACACCAATCTTCTAGACCAGATGCTCGATTCGGTTATCTATGCGATGACCAAGCT
CGGTTATCCGAACATTCCTCTCGCAATCTCCGAAACCGGGTGGCCTAATTCCGGTGATATCCATGAAATCGGAGCTAATA
TTCTCAACGCCGCGACGTATAACCGGAATTTGATCAAGAAGATGACTGCTAACCCGCCACTCGGTACACCAGCTAGGCGT
GGTTCACCTATACCGACGTTTTTGTTCTCCTTGTTCAATGAGAACCAGAAACCCGGTTCTGGAACAGAGAGGCATTGGGG
AATTTTGAATCCGGACGGTACACCGATCTACGACATCGACTTCAGCGGTACAAGATCAGTTTCCAGTTTTGGTACGTTGC
CTAAACCAAGTAACAATGTTCCCTTCAAGGGCAACGTGTGGTGTGTGGCGGTTGATGGGGCCGATGAGGCAGAGTTAGGG
CTGGCACTAAACTTTGCTTGCGGAAGAAACAATGAAACCTGTGCAGCGTTGGCGCCAGGGGGAGAATGCTATGCACCGGT
AACGGTTACTTGGCATGCAAGCTATGCGTTTAGCTCATACTGGGCTCAATTCCGGAACCAAAGCTCTCAATGCTACTTCA
ATGGTTTGGCGCGTGAGACCACGATCAACCCTGGAAATGAGCGTTGCAAATTTCCTAGCGTTACGCTGTGA