Details for Lyrate rockcress Locus 16050145

Position : sca3 ( 5`- 7371260 .. 7369623 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16050145

Protein [Map View]
MMKIPNLPDDLESEILCRVPAKSLTKLKTTCKRWHALFRDPRFVKQNLGKSAREVMLLMNHRVHSISVNRHGIHDGVDAS
MEFSGKLIRLSDSKDVKKLRVAVFEIYDFGSDSWRVLDDDMIWGIFSAGVSLNGDTFWIGGDKETGFFLMYFDFTTERFG
RFPLPYQSFDYEDIAVLSLVREEKLSLLNQNLHRNSSEMKIWVTNKFDEAKDLSWSQFLVVDFDKFTLPYVNSVISFFLD
EESKVAVCCYTDMEDEERTKIYIVGVDLYKEVYKEVTKGSILNWPCFVSYAPNLVHIQKTSPKGKKKMREKEVTQMNHLS
TDGRQTWQEALTQSDAKLKSNAYPNYVVE*

DNA
ATGATGAAGATTCCCAATCTTCCAGACGATTTGGAATCGGAAATACTCTGCAGGGTTCCGGCGAAGTCTCTAACGAAACT
GAAAACTACTTGTAAAAGATGGCACGCTTTGTTCAGAGATCCGAGATTCGTGAAGCAGAACTTGGGTAAATCAGCGAGGG
AAGTGATGTTACTGATGAATCATAGGGTTCACTCAATTAGCGTCAATCGCCATGGAATTCACGACGGAGTTGATGCATCT
ATGGAGTTCTCAGGTAAACTCATCAGGCTAAGCGATTCGAAAGATGTCAAAAAACTCCGGGTTGCTGTGTTTGAAATCTA
TGATTTTGGATCTGATTCTTGGAGGGTTCTTGATGATGATATGATTTGGGGCATATTTTCTGCTGGCGTTTCTTTGAATG
GAGATACTTTTTGGATTGGTGGAGACAAAGAAACTGGTTTTTTCTTGATGTATTTCGATTTCACAACAGAGAGATTTGGG
CGTTTTCCTCTTCCGTATCAGAGTTTCGATTATGAAGATATCGCGGTTCTATCACTTGTTAGGGAAGAAAAACTCTCCTT
GTTGAATCAGAATCTTCATAGAAATTCATCAGAGATGAAGATATGGGTGACCAATAAGTTTGATGAGGCCAAAGACTTGT
CATGGAGCCAGTTCCTAGTAGTGGATTTTGATAAATTTACGTTACCATATGTGAACAGCGTGATAAGTTTCTTCTTGGAC
GAGGAGAGTAAAGTGGCAGTGTGTTGTTATACAGACATGGAAGATGAAGAAAGGACCAAAATCTACATTGTTGGAGTGGA
TCTTTATAAAGAAGTCTATAAAGAGGTTACAAAGGGATCAATTCTCAACTGGCCATGTTTCGTCAGTTATGCTCCAAATT
TGGTTCACATTCAGAAAACCTCACCCAAAGGCAAAAAGAAAATGAGAGAAAAGGAGGTAACTCAAATGAATCACCTTAGC
ACGGACGGGAGGCAAACTTGGCAAGAAGCCTTAACGCAATCTGACGCGAAACTCAAATCCAACGCATATCCAAATTATGT
GGTGGAGTAA