Details for Lyrate rockcress Locus 16050123

Position : sca2 ( 5`- 16504307 .. 16503894 -3` )
Annotation : [B2G] zinc finger family protein
External links : CoGe
PGDD synteny : 16050123

Protein [Map View]
MAISMTITNEEDASNNFGCNICLELAREPIVTLCGHLFCWPCLYKWLHYHSQSNHCPVCKALVKEDSLVPLYGMGKPSSD
PRSKLSCGVTVPNRPAATRIETARPRLGERHHGSSFFGGHSGFAAMPTGTRFSNFLL*

DNA
ATGGCTATCAGCATGACCATCACGAACGAAGAAGATGCATCGAACAACTTTGGATGCAACATCTGTCTTGAATTGGCAAG
AGAACCAATCGTGACTCTATGTGGTCATTTGTTCTGTTGGCCTTGTCTCTACAAGTGGCTCCATTACCATTCTCAATCTA
ATCATTGTCCTGTTTGTAAAGCTTTGGTTAAGGAAGATAGTCTGGTTCCTTTGTATGGAATGGGTAAGCCATCTTCTGAC
CCGAGATCGAAACTCAGTTGTGGTGTTACTGTCCCTAATCGACCAGCTGCGACTAGGATTGAAACAGCTCGTCCTCGTCT
TGGAGAAAGACATCATGGGTCTAGTTTCTTTGGTGGGCATTCAGGTTTTGCTGCGATGCCAACTGGTACACGGTTTTCCA
ACTTCTTGTTGTAA