Details for Lyrate rockcress Locus 16050102

Position : sca3 ( 5`- 6608122 .. 6608742 -3` )
Annotation : [B2G] zinc finger (ran-binding) family protein
External links : CoGe
PGDD synteny : 16050102

Protein [Map View]
MNRPGDWNCRSCNHLNFQRRDSCQRCGDSRSGPGGVGGLDFGGFGGRAMSAFGFTTGSDVRPGDWYCTVGNCGTHNFASR
STCFKCGTFKDETGAGGGGGGIGGPAMFDADVMRSRVPSNGGRSSWKSGDWICTRIGCNEHNFASRIECFRCNAPRDFSN
RTSF*

DNA
ATGAACAGACCCGGAGATTGGAACTGCAGGTCATGCAACCACCTCAACTTCCAGCGCCGTGACTCTTGCCAGCGATGCGG
TGACTCTCGTTCCGGCCCTGGTGGAGTCGGTGGCTTAGACTTCGGTGGTTTCGGCGGCAGAGCCATGTCTGCTTTCGGAT
TTACCACCGGCTCCGACGTTCGTCCCGGTGATTGGTACTGCACCGTTGGAAACTGCGGGACACACAATTTCGCTAGTCGC
TCCACTTGCTTCAAATGCGGCACTTTCAAGGACGAGACAGGCGCTGGAGGCGGAGGCGGTGGCATCGGCGGTCCGGCCAT
GTTTGACGCCGACGTTATGCGGTCTAGAGTCCCCAGTAACGGTGGTCGCTCTAGCTGGAAATCCGGCGACTGGATTTGCA
CTAGGATTGGTTGCAATGAGCATAATTTTGCAAGCAGAATAGAATGCTTCAGATGCAATGCACCAAGGGACTTCAGCAAC
AGAACCTCTTTCTAA