Details for Lyrate rockcress Locus 16050096

Position : sca3 ( 5`- 3819138 .. 3821456 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16050096

Protein [Map View]
MNILRPPTSSPSFPPYPNSVSLTPPVSFTLPNTSITNAGRPTRRPIFQRSASGTANSSAGDLSSFLGSPSEAYSTHNDQE
LLFLLRNRKTDEAWAKYVQSTHLPGPTCLSRLVSQLSYQSKPESLTRAQSILTRLRNERQLHRLDANSLGLLAMAAAKSG
QTLYAVSVIKSMIRSGYLPHVKAWTAAVASLSAAGDDGPEESIKLFTAITRRVKRFGDQSLVAQSRPDTAAFNAVLNACA
NLGDTEKYWKLFDEMSEWDCEPDVLTYNVMIKLCARVDRKELIVYVLERIIDKGIKVCMTTMHSLVAAYVGFGDLRTAER
IVQAMREKRRDLCKVLRECNAEDLKEKEEEEAAEDDEDAFEDDEDSGYSARDEVSEEGFEDVFKKLLPNSVDPSGDPPLL
PKVFAPDSRIYTTLMKGYMKNGRVADTARMLEAMRRQDDRNSHPDEVTYTTVVSAFVKAGLMDRARQVLAEMARMGVPAN
RITYNVLLKGYCKQLQIDRAEDLLREMAEDAGIEPDVVSYNIIIDGCILIDDSAGALAFFNEMRTRGIAPTKISYTTLMK
AFAMSGQPKLANRVFDEMMNDPRVKVDLIAWNMLVEGYCRLGLIEDAQRVVSRMKENGFYPNVATYGSLANGVSLARKPG
EALLLWKEIKERCEVKKKEAPSDSSSDPSPPMLKPDEGLLDTLADICVRAAFFKKALEIIACMEENGIPPNKTKYKKIYV
EMHSRMFTSKHASQARIDRRVERKRAAEAFKFWLGLPNSYYGSEWKLGPRED*

DNA
ATGAACATTCTCCGACCGCCGACGTCATCACCGTCGTTTCCTCCATACCCAAACTCCGTTTCGTTAACCCCTCCGGTGTC
TTTCACACTCCCCAACACTTCCATCACCAACGCTGGTCGTCCCACGCGTCGCCCAATTTTCCAACGGTCCGCCTCCGGCA
CTGCTAATAGCTCCGCCGGAGACCTCTCGTCGTTCTTGGGCTCTCCTTCAGAGGCGTATTCAACACACAACGACCAAGAG
CTTTTGTTTCTCCTCCGCAATAGAAAAACCGATGAAGCTTGGGCTAAGTATGTTCAGTCAACTCATCTCCCTGGACCAAC
TTGTCTTAGCCGTTTAGTTTCTCAGTTATCTTATCAATCTAAACCCGAGAGTCTCACGCGCGCACAGTCTATCCTCACGC
GCCTCCGCAATGAACGCCAGCTTCATCGCTTGGACGCTAATTCTCTCGGTCTCCTCGCCATGGCTGCAGCGAAGTCTGGC
CAAACACTTTACGCTGTCTCCGTCATCAAATCCATGATTCGTTCTGGGTATTTACCTCACGTTAAAGCGTGGACAGCTGC
AGTAGCTAGTCTCTCTGCTGCCGGAGATGATGGACCGGAAGAATCTATCAAACTCTTTACCGCTATTACGCGACGAGTCA
AACGTTTCGGTGACCAGTCTTTGGTTGCTCAATCGAGGCCTGATACGGCGGCGTTTAACGCAGTGCTTAACGCTTGTGCA
AACCTTGGTGATACTGAGAAGTACTGGAAGTTGTTCGACGAAATGTCTGAGTGGGATTGTGAGCCTGATGTCTTGACTTA
CAATGTTATGATCAAGCTGTGTGCGAGGGTTGATCGGAAGGAATTGATTGTGTATGTGTTGGAGAGGATTATTGACAAGG
GGATTAAGGTTTGTATGACTACAATGCATTCCCTTGTTGCAGCATATGTTGGGTTCGGTGATTTGCGTACTGCGGAGAGA
ATTGTTCAAGCGATGAGGGAGAAAAGGAGAGATCTTTGTAAGGTTCTACGAGAATGCAATGCTGAGGATTTGAAGGAGAA
AGAAGAGGAAGAAGCAGCAGAAGATGATGAAGATGCGTTTGAGGATGATGAAGATTCGGGTTATTCGGCTCGGGATGAGG
TAAGTGAAGAGGGGTTTGAGGATGTGTTCAAGAAATTGCTGCCTAATTCGGTTGATCCGAGCGGTGACCCGCCATTGTTG
CCTAAAGTCTTTGCACCAGACTCAAGGATCTACACGACGTTGATGAAAGGTTATATGAAGAATGGGCGTGTGGCAGACAC
AGCTAGAATGCTTGAGGCGATGAGGCGTCAAGATGATAGAAACAGTCACCCAGATGAAGTTACATACACCACGGTTGTGT
CAGCTTTTGTAAAAGCTGGGTTGATGGATAGAGCACGACAAGTGTTAGCCGAGATGGCTCGGATGGGTGTTCCTGCAAAT
AGGATTACTTATAATGTTCTGCTCAAAGGATATTGTAAGCAGTTGCAGATAGATAGGGCAGAGGATTTACTAAGAGAGAT
GGCTGAAGATGCAGGGATTGAGCCAGATGTGGTTTCCTATAACATCATAATAGATGGATGCATTCTTATAGATGATAGCG
CAGGAGCTCTAGCGTTTTTCAATGAAATGAGAACGAGAGGGATTGCACCAACTAAGATTAGTTACACAACTTTGATGAAG
GCTTTTGCAATGTCGGGGCAACCCAAGTTGGCAAATAGGGTGTTTGATGAGATGATGAATGATCCAAGGGTCAAAGTTGA
TTTGATCGCTTGGAACATGTTGGTTGAAGGGTATTGCAGGCTAGGTTTGATTGAAGATGCTCAGAGAGTGGTTTCAAGAA
TGAAAGAAAACGGGTTTTACCCAAATGTAGCAACCTATGGGAGTCTAGCCAATGGGGTTTCTCTGGCGAGGAAACCTGGT
GAGGCGCTCTTGCTTTGGAAGGAAATAAAGGAAAGATGTGAGGTGAAAAAGAAAGAAGCACCTTCAGATTCTTCTTCAGA
TCCATCTCCTCCGATGTTGAAACCGGATGAAGGGTTGTTAGATACGCTAGCAGATATATGTGTCAGGGCTGCGTTTTTCA
AGAAGGCATTGGAGATAATCGCATGTATGGAAGAGAATGGGATACCTCCAAATAAGACTAAGTACAAGAAGATCTATGTG
GAGATGCACTCGAGGATGTTCACTAGCAAACATGCTTCACAAGCCAGAATAGATAGGCGGGTAGAACGAAAGAGAGCGGC
TGAAGCTTTCAAGTTTTGGCTCGGTTTACCTAATTCTTACTATGGAAGTGAATGGAAGTTAGGTCCAAGAGAAGACTAG