Details for Lyrate rockcress Locus 16050073

Position : sca3 ( 5`- 4031560 .. 4032309 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16050073

Protein [Map View]
MTLYLVENAIKSKDLVGNVTIRWDFMNISRDSYTANVTIFNYLKKQEAIEGPWELGWTWYEDEILLSTLSAKVSKQSNVL
KFGECCNHRVTFVDLPQQTDDDQRIVANCCKGGVIPSWFREADLAKSSSSFQISVGQVGIKFHPPPLDVMLTTQGLEYVC
DSLSEVMNTPGYL

DNA
ATGACTTTATATCTCGTAGAAAATGCAATTAAATCTAAGGACCTAGTCGGGAATGTGACAATAAGGTGGGACTTTATGAA
TATAAGTCGTGATAGTTACACGGCTAATGTCACAATCTTCAACTATTTGAAGAAGCAAGAAGCCATTGAAGGGCCATGGG
AATTAGGGTGGACATGGTACGAAGACGAAATTCTATTGAGCACTCTGAGTGCTAAAGTTTCAAAACAAAGTAATGTTCTG
AAATTTGGAGAGTGCTGCAATCATAGGGTGACCTTTGTGGACTTACCCCAACAAACTGATGATGACCAGCGAATTGTAGC
AAATTGTTGCAAGGGTGGTGTCATTCCTTCATGGTTTAGAGAAGCCGACCTTGCTAAAAGCTCTTCTTCATTCCAAATTA
GTGTTGGCCAAGTTGGGATAAAATTTCATCCCCCGCCATTAGACGTGATGTTGACCACACAAGGATTAGAATACGTATGT
GATTCGTTGTCGGAAGTAATGAATACTCCGGGTTATCTA